• Gene id: 3181

Gene Summary

• Gene Symbol: HNRNPA2B1   Gene   UCSC   Ensembl
• Aliases: HNRNPA2, HNRNPB1, HNRPA2, HNRPA2B1, HNRPB1, IBMPFD2, RNPA2, SNRPB1
• Gene name: heterogeneous nuclear ribonucleoprotein A2/B1
• Alternate names: heterogeneous nuclear ribonucleoproteins A2/B1, HNRNPA2B1/MYC fusion, epididymis secretory sperm binding protein, hnRNP A2 / hnRNP B1, nuclear ribonucleoprotein particle A2 protein,
• Gene location: 7p15.2 (22625822: 22622532)     Exons: 1     NC_000011.10
• Gene summary(Entrez): This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs i
• OMIM: 600124

Protein Summary

• Protein general information: P22626  
  • Name: Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2/B1)
  • Length: 353  
  • Mass: 37430
• Sequence:

  MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEV
  DAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSG
  KKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGS
  NFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNY
  NDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY

• Structural information:
  • Protein Domains: (21..10-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (112..19-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR034489  IPR034486  IPR012677  IPR035979  IPR000504  
  • Prosite: PS50102
  • CDD: cd12762
  • PDB: 1X4B 5EN1 5HO4 5WWE 5WWF 5WWG
  • PDBsum: 1X4B 5EN1 5HO4 5WWE 5WWF 5WWG
  • DIP: 32877
  • STRING: ENSP00000346694
• Other Databases: GeneCards:  HNRNPA2B1  Malacards:  HNRNPA2B1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006397	mRNA processing	IDA	biological process
GO:0003723	RNA binding	IDA	molecular function
GO:0043047	single-stranded telomeric DNA binding	IDA	molecular function
GO:0005681	spliceosomal complex	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0050658	RNA transport	IDA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0051252	regulation of RNA metabolic process	IBA	biological process
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0035198	miRNA binding	IDA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:1990428	miRNA transport	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0006406	mRNA export from nucleus	IDA	biological process
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0031053	primary miRNA processing	IDA	biological process
GO:0000398	mRNA splicing, via spliceosome	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0006406	mRNA export from nucleus	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0051028	mRNA transport	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035722	interleukin-12-mediated signaling pathway	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0016070	RNA metabolic process	TAS	biological process
GO:0070062	extracellular exosome	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097157	pre-mRNA intronic binding	IEA	molecular function
GO:0048025	negative regulation of mRNA splicing, via spliceosome	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0098505	G-rich strand telomeric DNA binding	ISS	molecular function
GO:1905663	positive regulation of telomerase RNA reverse transcriptase activity	ISS	biological process
GO:0000781	chromosome, telomeric region	ISS	cellular component
GO:0016363	nuclear matrix	ISS	cellular component
GO:0044806	G-quadruplex DNA unwinding	ISS	biological process
GO:1904358	positive regulation of telomere maintenance via telomere lengthening	ISS	biological process
GO:0015030	Cajal body	ISS	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Inclusion body myopathy with Paget disease of bone and frontotemporal dementia	KEGG:H02031
Inclusion body myopathy with Paget disease of bone and frontotemporal dementia	KEGG:H02031
Inclusion body myopathy with Paget disease of bone and frontotemporal dementia	PMID:23455423
Alzheimer's disease	PMID:22628224
lung non-small cell carcinoma	PMID:2846790
hepatocellular carcinoma	PMID:20604928
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881