• Gene id: 3178

Gene Summary

• Gene Symbol: HNRNPA1   Gene   UCSC   Ensembl
• Aliases: ALS19, ALS20, HNRPA1, HNRPA1L3, IBMPFD3, UP 1, hnRNP A1, hnRNP-A1
• Gene name: heterogeneous nuclear ribonucleoprotein A1
• Alternate names: heterogeneous nuclear ribonucleoprotein A1, epididymis secretory sperm binding protein, helix-destabilizing protein, heterogeneous nuclear ribonucleoprotein A1B protein, heterogeneous nuclear ribonucleoprotein B2 protein, heterogeneous nuclear ribonucleoprotei,
• Gene location: 12q13.13 (54280725: 54287086)     Exons: 12     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of
• OMIM: 164017

Protein Summary

• Protein general information: P09651  
  • Name: Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix destabilizing protein) (Single strand RNA binding protein) (hnRNP core protein A1) [Cleaved into: Heterogeneous nuclear ribonucleoprotein A1, N terminally processed]
  • Length: 372  
  • Mass: 38747
• Sequence:

  MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNAR
  PHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAF
  VTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGR
  GGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGG
  GSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF

• Structural information:
  • Protein Domains: (14..9-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (105..18-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR021662  IPR034845  IPR034803  IPR012677  IPR035979   IPR000504  
  • Prosite: PS50102
  • CDD: cd12761 cd12580
  • PDB: 1HA1 1L3K 1PGZ 1PO6 1U1K 1U1L 1U1M 1U1N 1U1O 1U1P 1U1Q 1U1R 1UP1 2H4M 2LYV 2UP1 4YOE 5MPG 5MPL 5ZGD 5ZGL 6BXX 6DCL 6J60
  • PDBsum: 1HA1 1L3K 1PGZ 1PO6 1U1K 1U1L 1U1M 1U1N 1U1O 1U1P 1U1Q 1U1R 1UP1 2H4M 2LYV 2UP1 4YOE 5MPG 5MPL 5ZGD 5ZGL 6BXX 6DCL 6J60
  • DIP: 29338
  • STRING: ENSP00000341826
• Other Databases: GeneCards:  HNRNPA1  Malacards:  HNRNPA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006405	RNA export from nucleus	IC	biological process
GO:0003727	single-stranded RNA binding	IC	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0005681	spliceosomal complex	IDA	cellular component
GO:0051168	nuclear export	IDA	biological process
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0051170	import into nucleus	IDA	biological process
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0051252	regulation of RNA metabolic process	IBA	biological process
GO:0003729	mRNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0035198	miRNA binding	IDA	molecular function
GO:1903936	cellular response to sodium arsenite	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0051028	mRNA transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0016070	RNA metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032212	positive regulation of telomere maintenance via telomerase	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0061752	telomeric repeat-containing RNA binding	IDA	molecular function
GO:0061752	telomeric repeat-containing RNA binding	IDA	molecular function
GO:0098505	G-rich strand telomeric DNA binding	IDA	molecular function
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0032211	negative regulation of telomere maintenance via telomerase	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005681	spliceosomal complex	IDA	cellular component
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IMP	biological process
GO:0042149	cellular response to glucose starvation	IMP	biological process
GO:0036002	pre-mRNA binding	IDA	molecular function
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Associated diseases	References
Amyotrophic lateral sclerosis	KEGG:H00058
Inclusion body myopathy with Paget disease of bone and frontotemporal dementia	KEGG:H02031
Amyotrophic lateral sclerosis	KEGG:H00058
Inclusion body myopathy with Paget disease of bone and frontotemporal dementia	KEGG:H02031
Alzheimer's disease	PMID:22628224
lung non-small cell carcinoma	PMID:20716340
hepatocellular carcinoma	PMID:23633480
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)