• Gene id: 317761

Gene Summary

• Gene Symbol: C14orf39   Gene   UCSC   Ensembl
• Aliases: Six6os1
• Gene name: chromosome 14 open reading frame 39
• Alternate names: protein SIX6OS1, six6 opposite strand transcript 1,
• Gene location: 14q23.1 (60499773: 60435953)     Exons: 20     NC_000014.9
• OMIM: 600763

Protein Summary

• Protein general information: Q8N1H7  
  • Name: Protein SIX6OS1 (Six6 opposite strand transcript 1)
  • Length: 587  
  • Mass: 68166
  • Tissue specificity: Highest expression in retina, skeletal muscle and colon. {ECO
• Sequence:

  MNDSLFVSLDRLLLEFVFQYEQDISTKEEMIQRINKCCEDIKENKVTICRIHETINATDEEIDHYCKHSEEIKDN
  CRNWKPTCDVFRKHEDYMQDQFTVYQGTVEKDKEMYHDYICQYKEVLKQYQLKYSETPFSREYYEKKREHEEIQS
  RVLACTEQLKMNETIFMKFRVPAPFPSLTKWTLNIVNLRCETQDILKHASNLTKSSSELKKEVDEMEIEINYLNQ
  QISRHNETKALSETLEEKNKNTENRKELKERIFGKDEHVLTLNKTQSSQLFLPYESQKLVRPIKMHSSEPRVADI
  KEESSAKQSKLANIDFRQKENDTQIFNDSAVDNHSKCSHITTITSSQKFMQVRLLTPQKQSNSNQWSEKGDKDAE
  YGDKGTVRQVRESKCTSQAIYTEHFGKSVENDSDEVEERAENFPRTSEIPIFLGTPKAVKAPESLEKIKFPKTPP
  FEINRNRNAVPEVQTEKESPGLSFLMSYTSRSPGLNLFDSSVFDTEISSDQFNEHYSARNLNPLSSEQEIGNLLE
  KPEGEDGFTFSFPSDTSTHTFGAGKDDFSFPFSFGQGQNSIPSSSLKGFSSSSQNTTQFTFF

• Structural information:
  • Interpro: IPR031380  
  • STRING: ENSP00000324920
• Other Databases: GeneCards:  C14orf39  Malacards:  C14orf39

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048477	oogenesis	IBA	biological process
GO:0010705	meiotic DNA double-strand break processing involved in reciprocal meiotic recombination	IBA	biological process
GO:0007283	spermatogenesis	IBA	biological process
GO:0007129	synapsis	IBA	biological process
GO:0000801	central element	IBA	cellular component
GO:0048477	oogenesis	ISS	biological process
GO:0010705	meiotic DNA double-strand break processing involved in reciprocal meiotic recombination	ISS	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0007129	synapsis	ISS	biological process
GO:0000801	central element	ISS	cellular component
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0006310	DNA recombination	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007129	synapsis	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0010705	meiotic DNA double-strand break processing involved in reciprocal meiotic recombination	IEA	biological process
GO:0048477	oogenesis	IEA	biological process
GO:0000801	central element	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0051090	regulation of DNA-binding transcription factor activity	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq