• Gene id: 317701

Gene Summary

• Gene Symbol: VN1R2   Gene   UCSC   Ensembl
• Aliases: V1RL2
• Gene name: vomeronasal 1 receptor 2
• Alternate names: vomeronasal type-1 receptor 2, G-protein coupled receptor GPCR25, V1R-like 2, V1r-like receptor 2, hGPCR25, pheromone receptor,
• Gene location: 19q13.42 (53258291: 53259601)     Exons: 1     NC_000019.10

Protein Summary

• Protein general information: Q8NFZ6  
  • Name: Vomeronasal type 1 receptor 2 (G protein coupled receptor GPCR25) (hGPCR25) (V1r like receptor 2)
  • Length: 395  
  • Mass: 44476
• Sequence:

  MTHTLYPTPFALYPINISAAWHLGPLPVSCFVSNKYQCSLAFGATTGLRVLVVVVPQTQLSFLSSLCLVSLFLHS
  LVSAHGEKPTKPVGLDPTLFQVVVGILGNFSLLYYYMFLYFRGYKPRSTDLILRHLTVADSLVILSKRIPETMAT
  FGLKHFDNYFGCKFLLYAHRVGRGVSIGSTCLLSVFQVITINPRNSRWAEMKVKAPTYIGLSNILCWAFHMLVNA
  IFPIYTTGKWSNNNITKKGDLGYCSAPLSDEVTKSVYAALTSFHDVLCLGLMLWASSSIVLVLYRHKQQVQHICR
  NNLYPNSSPGNRAIQSILALVSTFALCYALSFITYVYLALFDNSSWWLVNTAALIIACFPTISPFVLMCRDPSRS
  RLCSICCRRNRRFFHDFRKM

• Structural information:
  • Interpro: IPR017452  IPR004072  
  • Prosite: PS50262
  • CDD: cd13949
  • STRING: ENSP00000351244
• Other Databases: GeneCards:  VN1R2  Malacards:  VN1R2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016503	pheromone receptor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0019236	response to pheromone	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)