• Gene id: 317649

Gene Summary

• Gene Symbol: EIF4E3   Gene   UCSC   Ensembl
• Aliases: eIF-4E3, eIF4E-3
• Gene name: eukaryotic translation initiation factor 4E family member 3
• Alternate names: eukaryotic translation initiation factor 4E type 3,
• Gene location: 3p13 (71754772: 71675413)     Exons: 13     NC_000003.12
• Gene summary(Entrez): EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure of mRNA and recruit mRNA to the ribosome (Joshi et al., 2004 [PubMed 15153109]).[supplied by OMIM, Mar 2008]
• OMIM: 609896

Protein Summary

• Protein general information: Q8N5X7  
  • Name: Eukaryotic translation initiation factor 4E type 3 (eIF 4E type 3) (eIF 4E3) (eIF4E type 3) (eIF4E 3)
  • Length: 224  
  • Mass: 24441
• Sequence:

  MALPPAAAPPAGAREPPGSRAAAAAAAPEPPLGLQQLSALQPEPGGVPLHSSWTFWLDRSLPGATAAECASNLKK
  IYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQ
  FTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH

• Structural information:
  • Interpro: IPR023398  IPR001040  
  • STRING: ENSP00000393324
• Other Databases: GeneCards:  EIF4E3  Malacards:  EIF4E3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003743	translation initiation factor activity	IBA	molecular function
GO:0000340	RNA 7-methylguanosine cap binding	IBA	molecular function
GO:0016281	eukaryotic translation initiation factor 4F complex	IBA	cellular component
GO:0005845	mRNA cap binding complex	ISS	cellular component
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0006413	translational initiation	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0006413	translational initiation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq