• Gene id: 3163

Gene Summary

• Gene Symbol: HMOX2   Gene   UCSC   Ensembl
• Aliases: HO-2
• Gene name: heme oxygenase 2
• Alternate names: heme oxygenase 2, heme oxygenase (decycling) 2,
• Gene location: 16p13.3 (4474696: 4510346)     Exons: 8     NC_000016.10
• Gene summary(Entrez): Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its subs
• OMIM: 141251

Protein Summary

• Protein general information: P30519  
  • Name: Heme oxygenase 2 (HO 2) (EC 1.14.14.18)
  • Length: 316  
  • Mass: 36033
• Sequence:

  MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALY
  FTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELLV
  AHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANK
  AFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFIL
  AAGVALAAGLLAWYYM

• Structural information:
  • Interpro: IPR002051  IPR016053  IPR016084  IPR018207  
  • Prosite: PS00593
  • PDB: 2Q32 2QPP 2RGZ 4WMH 5UC8 5UC9 5UCA
  • PDBsum: 2Q32 2QPP 2RGZ 4WMH 5UC8 5UC9 5UCA
  • DIP: 53564
  • STRING: ENSP00000477572
• Other Databases: GeneCards:  HMOX2  Malacards:  HMOX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006979	response to oxidative stress	IBA	biological process
GO:0042167	heme catabolic process	IBA	biological process
GO:0055072	iron ion homeostasis	IBA	biological process
GO:0004392	heme oxygenase (decyclizing) activity	IBA	molecular function
GO:0006788	heme oxidation	IBA	biological process
GO:0020037	heme binding	IBA	molecular function
GO:0004392	heme oxygenase (decyclizing) activity	IEA	molecular function
GO:0006788	heme oxidation	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004392	heme oxygenase (decyclizing) activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0042167	heme catabolic process	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006879	cellular iron ion homeostasis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0004392	heme oxygenase (decyclizing) activity	IDA	molecular function
GO:0001666	response to hypoxia	IDA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04978	Mineral absorption
hsa00860	Porphyrin and chlorophyll metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray