• Gene id: 3162

Gene Summary

• Gene Symbol: HMOX1   Gene   UCSC   Ensembl
• Aliases: HMOX1D, HO-1, HSP32, bK286B10
• Gene name: heme oxygenase 1
• Alternate names: heme oxygenase 1, heat shock protein, 32-kD, heme oxygenase (decycling) 1,
• Gene location: 22q12.3 (35381066: 35394213)     Exons: 5     NC_000022.11
• Gene summary(Entrez): Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its subs
• OMIM: 141250

Protein Summary

• Protein general information: P09601  
  • Name: Heme oxygenase 1 (HO 1) (EC 1.14.14.18)
  • Length: 288  
  • Mass: 32,819
• Sequence:

  MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFA
  PVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKI
  AQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDT
  KDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM

• Structural information:
  • Interpro: IPR002051  IPR016053  IPR016084  IPR018207  
  • Prosite: PS00593
  • CDD: cd00232
  • PDB: 1N3U 1N45 1NI6 1OYK 1OYL 1OZE 1OZL 1OZR 1OZW 1S13 1S8C 1T5P 1TWN 1TWR 1XJZ 1XK0 1XK1 1XK2 1XK3 3CZY 3HOK 3K4F 3TGM 4WD4 5BTQ
  • PDBsum: 1N3U 1N45 1NI6 1OYK 1OYL 1OZE 1OZL 1OZR 1OZW 1S13 1S8C 1T5P 1TWN 1TWR 1XJZ 1XK0 1XK1 1XK2 1XK3 3CZY 3HOK 3K4F 3TGM 4WD4 5BTQ
  • STRING: ENSP00000216117
• Other Databases: GeneCards:  HMOX1  Malacards:  HMOX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	TAS	biological process
GO:0001935	endothelial cell proliferation	TAS	biological process
GO:0002246	wound healing involved in inflammatory response	IMP	biological process
GO:0002686	negative regulation of leukocyte migration	TAS	biological process
GO:0004392	heme oxygenase (decyclizing) activity	IDA	molecular function
GO:0004392	heme oxygenase (decyclizing) activity	IMP	molecular function
GO:0004392	heme oxygenase (decyclizing) activity	TAS	molecular function
GO:0004630	phospholipase D activity	IEA	molecular function
GO:0004871	signal transducer activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005901	caveola	IEA	cellular component
GO:0006788	heme oxidation	IDA	biological process
GO:0006879	cellular iron ion homeostasis	IMP	biological process
GO:0006879	cellular iron ion homeostasis	TAS	biological process
GO:0006979	response to oxidative stress	IMP	biological process
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0007588	excretion	IC	biological process
GO:0008217	regulation of blood pressure	IEA	biological process
GO:0008219	cell death	ISS	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0010656	negative regulation of muscle cell apoptotic process	IEA	biological process
GO:0014806	smooth muscle hyperplasia	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0019899	enzyme binding	ISS	molecular function
GO:0020037	heme binding	IDA	molecular function
GO:0031670	cellular response to nutrient	IEA	biological process
GO:0032764	negative regulation of mast cell cytokine production	IEA	biological process
GO:0034101	erythrocyte homeostasis	IMP	biological process
GO:0034383	low-density lipoprotein particle clearance	TAS	biological process
GO:0034395	regulation of transcription from RNA polymerase II promoter in response to iron	IEA	biological process
GO:0034605	cellular response to heat	IMP	biological process
GO:0035094	response to nicotine	IDA	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0042167	heme catabolic process	IDA	biological process
GO:0042167	heme catabolic process	TAS	biological process
GO:0042542	response to hydrogen peroxide	ISS	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0043305	negative regulation of mast cell degranulation	IEA	biological process
GO:0043392	negative regulation of DNA binding	IEA	biological process
GO:0043433	negative regulation of sequence-specific DNA binding transcription factor activity	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0043619	regulation of transcription from RNA polymerase II promoter in response to oxidative stress	ISS	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0045080	positive regulation of chemokine biosynthetic process	TAS	biological process
GO:0045765	regulation of angiogenesis	TAS	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0045909	positive regulation of vasodilation	IC	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IDA	biological process
GO:0051090	regulation of sequence-specific DNA binding transcription factor activity	ISS	biological process
GO:0051260	protein homooligomerization	IDA	biological process
GO:0055072	iron ion homeostasis	IDA	biological process
GO:0055072	iron ion homeostasis	IMP	biological process
GO:0071243	cellular response to arsenic-containing substance	IEA	biological process
GO:0071276	cellular response to cadmium ion	IEA	biological process
GO:0071456	cellular response to hypoxia	IEP	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IMP	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001525	angiogenesis	TAS	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001935	endothelial cell proliferation	TAS	biological process
GO:0002246	wound healing involved in inflammatory response	IMP	biological process
GO:0002686	negative regulation of leukocyte migration	TAS	biological process
GO:0004392	heme oxygenase (decyclizing) activity	IEA	molecular function
GO:0004392	heme oxygenase (decyclizing) activity	IEA	molecular function
GO:0004392	heme oxygenase (decyclizing) activity	IDA	molecular function
GO:0004392	heme oxygenase (decyclizing) activity	IMP	molecular function
GO:0004392	heme oxygenase (decyclizing) activity	TAS	molecular function
GO:0004392	heme oxygenase (decyclizing) activity	TAS	molecular function
GO:0004630	phospholipase D activity	IEA	molecular function
GO:0004871	signal transducer activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005901	caveola	IEA	cellular component
GO:0006788	heme oxidation	IEA	biological process
GO:0006788	heme oxidation	IDA	biological process
GO:0006879	cellular iron ion homeostasis	IMP	biological process
GO:0006879	cellular iron ion homeostasis	TAS	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0006979	response to oxidative stress	IMP	biological process
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0007588	excretion	IC	biological process
GO:0008217	regulation of blood pressure	IEA	biological process
GO:0008219	cell death	IEA	biological process
GO:0008219	cell death	ISS	biological process
GO:0008285	negative regulation of cell proliferation	IEA	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0010656	negative regulation of muscle cell apoptotic process	IEA	biological process
GO:0014806	smooth muscle hyperplasia	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0019899	enzyme binding	IEA	molecular function
GO:0019899	enzyme binding	ISS	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0020037	heme binding	IDA	molecular function
GO:0031670	cellular response to nutrient	IEA	biological process
GO:0032764	negative regulation of mast cell cytokine production	IEA	biological process
GO:0034101	erythrocyte homeostasis	IMP	biological process
GO:0034383	low-density lipoprotein particle clearance	TAS	biological process
GO:0034395	regulation of transcription from RNA polymerase II promoter in response to iron	IEA	biological process
GO:0034605	cellular response to heat	IMP	biological process
GO:0035094	response to nicotine	IDA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0042167	heme catabolic process	IEA	biological process
GO:0042167	heme catabolic process	IDA	biological process
GO:0042167	heme catabolic process	TAS	biological process
GO:0042168	heme metabolic process	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0042542	response to hydrogen peroxide	ISS	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0043305	negative regulation of mast cell degranulation	IEA	biological process
GO:0043392	negative regulation of DNA binding	IEA	biological process
GO:0043433	negative regulation of sequence-specific DNA binding transcription factor activity	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0043619	regulation of transcription from RNA polymerase II promoter in response to oxidative stress	IEA	biological process
GO:0043619	regulation of transcription from RNA polymerase II promoter in response to oxidative stress	ISS	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0045080	positive regulation of chemokine biosynthetic process	TAS	biological process
GO:0045765	regulation of angiogenesis	TAS	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0045909	positive regulation of vasodilation	IC	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IEA	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IDA	biological process
GO:0051090	regulation of sequence-specific DNA binding transcription factor activity	IEA	biological process
GO:0051090	regulation of sequence-specific DNA binding transcription factor activity	ISS	biological process
GO:0051260	protein homooligomerization	IDA	biological process
GO:0055072	iron ion homeostasis	IDA	biological process
GO:0055072	iron ion homeostasis	IMP	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0071243	cellular response to arsenic-containing substance	IEA	biological process
GO:0071276	cellular response to cadmium ion	IEA	biological process
GO:0071456	cellular response to hypoxia	IEP	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IMP	biological process
GO:0001525	angiogenesis	TAS	biological process
GO:0001935	endothelial cell proliferation	TAS	biological process
GO:0002246	wound healing involved in inflammatory response	IMP	biological process
GO:0002686	negative regulation of leukocyte migration	TAS	biological process
GO:0004392	heme oxygenase (decyclizing) activity	IDA	molecular function
GO:0004392	heme oxygenase (decyclizing) activity	IMP	molecular function
GO:0004392	heme oxygenase (decyclizing) activity	TAS	molecular function
GO:0004392	heme oxygenase (decyclizing) activity	TAS	molecular function
GO:0004871	signal transducer activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006788	heme oxidation	IDA	biological process
GO:0006879	cellular iron ion homeostasis	IMP	biological process
GO:0006879	cellular iron ion homeostasis	TAS	biological process
GO:0006979	response to oxidative stress	IMP	biological process
GO:0007588	excretion	IC	biological process
GO:0008219	cell death	ISS	biological process
GO:0014806	smooth muscle hyperplasia	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0019899	enzyme binding	ISS	molecular function
GO:0020037	heme binding	IDA	molecular function
GO:0034101	erythrocyte homeostasis	IMP	biological process
GO:0034383	low-density lipoprotein particle clearance	TAS	biological process
GO:0034605	cellular response to heat	IMP	biological process
GO:0035094	response to nicotine	IDA	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0042167	heme catabolic process	IDA	biological process
GO:0042167	heme catabolic process	TAS	biological process
GO:0042542	response to hydrogen peroxide	ISS	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0043619	regulation of transcription from RNA polymerase II promoter in response to oxidative stress	ISS	biological process
GO:0045080	positive regulation of chemokine biosynthetic process	TAS	biological process
GO:0045765	regulation of angiogenesis	TAS	biological process
GO:0045909	positive regulation of vasodilation	IC	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IDA	biological process
GO:0051090	regulation of sequence-specific DNA binding transcription factor activity	ISS	biological process
GO:0051260	protein homooligomerization	IDA	biological process
GO:0055072	iron ion homeostasis	IDA	biological process
GO:0055072	iron ion homeostasis	IMP	biological process
GO:0071456	cellular response to hypoxia	IEP	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04066	HIF-1 signaling pathway
hsa04216	Ferroptosis
hsa04978	Mineral absorption
hsa05200	Pathways in cancer
hsa05206	MicroRNAs in cancer
hsa05225	Hepatocellular carcinoma
hsa05418	Fluid shear stress and atherosclerosis

Diseases

Associated diseases	References
Cancer (oral)	GAD: 16387424
Cancer (stomach)	GAD: 17520317
Cancer	GAD: 19255063
Cancer (bladder)	GAD: 18200441
Cancer (gastric)	GAD: 19236506
Cancer (lung)	GAD: 15688187
Cancer (melanoma)	GAD: 16596642
Cancer (breast)	GAD: 19255063
Aneurysm	GAD: 12182912
Aortic aneurysm	GAD: 12182912
Apoplexy	GAD: 20175935
Atherosclerosis	GAD: 15028349
Cardiovascular disease	GAD: 15064108
Cerebrovascular disease	GAD: 15140586
Coronary heart disease	GAD: 12136229
Hypertension	GAD: 12872043
Restenosis	GAD: 17400606
Venous thromboembolism	GAD: 18201862
Kawasaki disease	GAD: 14521259
Arthritis	GAD: 18975324
Asthma	GAD: 20599261
Chronic ulcerative colitis	GAD: 20509889
Obesity	GAD: 19884647
Metabolic syndrome	GAD: 19056482
Diabetes	GAD: 12136229
Subarachnoid hemorrhage	GAD: 16455537
Alzheimer's disease	GAD: 19246912
Parkinson disease	GAD: 20039940
Cirrhosis	GAD: 15885363
Chronic renal failure	GAD: 21085059
Kidney diseases	GAD: 19578796
Abortion	GAD: 20587610
Recurrent pregnancy loss (RPL)	GAD: 14981149
Recurrent pregnancy loss (RPL)	GAD: 14981149
Recurrent pregnancy loss (RPL)	GAD: 14981149
Oocyte competence	INFBASE: 24607880
Preeclampsia	INFBASE: 19399816
Polycystic ovary syndrome (PCOS)	INFBASE: 24585089
Oocyte quality	INFBASE: 24607880
Peritoneal endometriosis	INFBASE: 11872213
Oligoasthenoteratozoospermia	MIK: 20629646
Varicocele	MIK: 20629646
Male factor infertility	MIK: 21556890
Testis tissue protection	MIK: 21898994
Endometriosis	INFBASE: 11872213
Azoospermia	MIK: 21898994
Chronic obstructive pulmonary disease (COPD)	GAD: 12149538
Lung disease	GAD: 12153964
Chronic toxic encephalopathy	GAD: 14992466
Respiratory distress syndrome	GAD: 19526221
Emphysema	GAD: 10631150
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 18811919
Oligoasthenoteratozoospermia	MIK: 20629646
Varicocele	MIK: 20629646
Teratozoospermia	MIK: 17327269
Testis tissue protection	MIK: 21898994
Azoopsermia	MIK: 21898994

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21898994	Testis tissue protection, Azoopsermia				Male infertility
21556890	Male infertility	GT-repeats alleles in the promoter of HO-		200 (100 cases, 100 normal controls)	Male infertility
18811919	Male infertility			120 (20 obstructive azoospermia, 25 nonobstructive azoospermia (NOA), 35 oligozoospermia, 40 normozoospermia )	Male infertility
20629646	Oligoasthenoteratozoospermia, varicocele			93 (healthy fertile controls (n = 34), OAT without varicocele (n = 37) and OAT associated with varicocele (n = 22))	Male infertility	HO
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881