• Gene id: 3150

Gene Summary

• Gene Symbol: HMGN1   Gene   UCSC   Ensembl
• Aliases: HMG14
• Gene name: high mobility group nucleosome binding domain 1
• Alternate names: non-histone chromosomal protein HMG-14, high mobility group nucleosome-binding domain-containing protein 1, high-mobility group (nonhistone chromosomal) protein 14, high-mobility group nucleosome binding 1, nonhistone chromosomal protein HMG-14,
• Gene location: 21q22.2 (39349087: 39342314)     Exons: 10     NC_000021.9
• Gene summary(Entrez): The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMG17, the encoded protein may help maintain an open chromatin configuration around transcribable genes. [provi
• OMIM: 163920

Protein Summary

• Protein general information: P05114  
  • Name: Non histone chromosomal protein HMG 14 (High mobility group nucleosome binding domain containing protein 1)
  • Length: 100  
  • Mass: 10659
• Sequence:

  MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLP
  AENGETKTEESPASDEAGEKEAKSD

• Structural information:
  • Interpro: IPR000079  
  • Prosite: PS00355
  • STRING: ENSP00000370125
• Other Databases: GeneCards:  HMGN1  Malacards:  HMGN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031492	nucleosomal DNA binding	IEA	molecular function
GO:0000785	chromatin	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0000785	chromatin	TAS	cellular component
GO:0032786	positive regulation of DNA-templated transcription, elongation	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:1901666	positive regulation of NAD+ ADP-ribosyltransferase activity	IEA	biological process
GO:0048597	post-embryonic camera-type eye morphogenesis	IEA	biological process
GO:0010224	response to UV-B	IEA	biological process
GO:0006283	transcription-coupled nucleotide-excision repair	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0050678	regulation of epithelial cell proliferation	IEA	biological process
GO:0040034	regulation of development, heterochronic	IEA	biological process
GO:0010225	response to UV-C	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0000720	pyrimidine dimer repair by nucleotide-excision repair	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)