• Gene id: 3146

Gene Summary

• Gene Symbol: HMGB1   Gene   UCSC   Ensembl
• Aliases: HMG-1, HMG1, HMG3, SBP-1
• Gene name: high mobility group box 1
• Alternate names: high mobility group protein B1, Amphoterin, Sulfoglucuronyl carbohydrate binding protein, high-mobility group (nonhistone chromosomal) protein 1,
• Gene location: 13q12.3 (30617596: 30456703)     Exons: 9     NC_000013.11
• Gene summary(Entrez): This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular proces
• OMIM: 163905

Protein Summary

• Protein general information: P09429  
  • Name: High mobility group protein B1 (High mobility group protein 1) (HMG 1)
  • Length: 215  
  • Mass: 24894
  • Tissue specificity: Ubiquituous. Expressed in platelets (PubMed
• Sequence:

  MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREM
  KTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK
  LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

• Structural information:
  • Interpro: IPR009071  IPR036910  IPR017967  
  • Prosite: PS00353 PS50118
  • PDB: 2LY4 2RTU 2YRQ 6CG0 6CIJ 6CIK 6CIL 6CIM
  • PDBsum: 2LY4 2RTU 2YRQ 6CG0 6CIJ 6CIK 6CIL 6CIM
  • DIP: 24195
  • STRING: ENSP00000345347
• Other Databases: GeneCards:  HMGB1  Malacards:  HMGB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0071222	cellular response to lipopolysaccharide	ISS	biological process
GO:0043537	negative regulation of blood vessel endothelial cell migration	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:2000343	positive regulation of chemokine (C-X-C motif) ligand 2 production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:0050716	positive regulation of interleukin-1 secretion	IBA	biological process
GO:0032755	positive regulation of interleukin-6 production	IBA	biological process
GO:0032502	developmental process	IBA	biological process
GO:0010469	regulation of signaling receptor activity	IBA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:1902741	positive regulation of interferon-alpha secretion	IBA	biological process
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0060326	cell chemotaxis	IBA	biological process
GO:0050718	positive regulation of interleukin-1 beta secretion	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0045089	positive regulation of innate immune response	IBA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IBA	biological process
GO:0010508	positive regulation of autophagy	IBA	biological process
GO:0008301	DNA binding, bending	IBA	molecular function
GO:0008134	transcription factor binding	IBA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0006338	chromatin remodeling	IBA	biological process
GO:0006310	DNA recombination	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0002218	activation of innate immune response	IBA	biological process
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0050716	positive regulation of interleukin-1 secretion	IDA	biological process
GO:0002643	regulation of tolerance induction	IDA	biological process
GO:1990774	tumor necrosis factor secretion	IDA	biological process
GO:2000778	positive regulation of interleukin-6 secretion	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0046330	positive regulation of JNK cascade	IDA	biological process
GO:0032425	positive regulation of mismatch repair	IDA	biological process
GO:0097350	neutrophil clearance	IDA	biological process
GO:0001786	phosphatidylserine binding	IDA	molecular function
GO:0043371	negative regulation of CD4-positive, alpha-beta T cell differentiation	IDA	biological process
GO:0035711	T-helper 1 cell activation	IDA	biological process
GO:0032733	positive regulation of interleukin-10 production	IDA	biological process
GO:0016829	lyase activity	IDA	molecular function
GO:0032072	regulation of restriction endodeoxyribonuclease activity	IDA	biological process
GO:0043277	apoptotic cell clearance	IDA	biological process
GO:0032689	negative regulation of interferon-gamma production	IDA	biological process
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0070182	DNA polymerase binding	IDA	molecular function
GO:0090026	positive regulation of monocyte chemotaxis	IDA	biological process
GO:0019958	C-X-C chemokine binding	IDA	molecular function
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0002218	activation of innate immune response	IDA	biological process
GO:0001530	lipopolysaccharide binding	IDA	molecular function
GO:0051106	positive regulation of DNA ligation	ISS	biological process
GO:2001200	positive regulation of dendritic cell differentiation	IMP	biological process
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0045063	T-helper 1 cell differentiation	IMP	biological process
GO:0032735	positive regulation of interleukin-12 production	IMP	biological process
GO:0042104	positive regulation of activated T cell proliferation	IMP	biological process
GO:0002840	regulation of T cell mediated immune response to tumor cell	ISS	biological process
GO:0034165	positive regulation of toll-like receptor 9 signaling pathway	ISS	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0006310	DNA recombination	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0000405	bubble DNA binding	ISS	molecular function
GO:0097100	supercoiled DNA binding	ISS	molecular function
GO:0008301	DNA binding, bending	ISS	molecular function
GO:0000400	four-way junction DNA binding	ISS	molecular function
GO:0032392	DNA geometric change	ISS	biological process
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006309	apoptotic DNA fragmentation	TAS	biological process
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0045087	innate immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:2000426	negative regulation of apoptotic cell clearance	IDA	biological process
GO:1905564	positive regulation of vascular endothelial cell proliferation	IMP	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IMP	biological process
GO:0035868	alphav-beta3 integrin-HMGB1 complex	IDA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050918	positive chemotaxis	IEA	biological process
GO:0043388	positive regulation of DNA binding	IDA	biological process
GO:0043388	positive regulation of DNA binding	IDA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0033151	V(D)J recombination	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0017055	negative regulation of RNA polymerase II transcription preinitiation complex assembly	IDA	biological process
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0000793	condensed chromosome	IDA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0050786	RAGE receptor binding	ISS	molecular function
GO:0031175	neuron projection development	ISS	biological process
GO:0005125	cytokine activity	ISS	molecular function
GO:0051103	DNA ligation involved in DNA repair	ISS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0042056	chemoattractant activity	ISS	molecular function
GO:0008301	DNA binding, bending	IMP	molecular function
GO:0008301	DNA binding, bending	ISS	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003697	single-stranded DNA binding	ISS	molecular function
GO:0001773	myeloid dendritic cell activation	ISS	biological process
GO:0003690	double-stranded DNA binding	ISS	molecular function
GO:0002437	inflammatory response to antigenic stimulus	IEP	biological process
GO:0070491	repressing transcription factor binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0006310	DNA recombination	ISS	biological process
GO:0006265	DNA topological change	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003684	damaged DNA binding	ISS	molecular function
GO:0002407	dendritic cell chemotaxis	ISS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IGI	biological process
GO:0006342	chromatin silencing	IGI	biological process

KEGG pathways

Pathway id	Pathway name
hsa04140	Autophagy - animal
hsa04217	Necroptosis
hsa03410	Base excision repair

Diseases

Associated diseases	References
Kawasaki disease	PMID:18720262
Amyotrophic lateral sclerosis	PMID:23639787
Cerebral infarction	PMID:23288172
systemic scleroderma	PMID:18825489
congestive heart failure	PMID:23708738
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881