• Gene id: 3122

Gene Summary

• Gene Symbol: HLA-DRA   Gene   UCSC   Ensembl
• Aliases: HLA-DRA1
• Gene name: major histocompatibility complex, class II, DR alpha
• Alternate names: HLA class II histocompatibility antigen, DR alpha chain, MHC class II antigen DRA, histocompatibility antigen HLA-DR alpha,
• Gene location: 6p21.32 (32439841: 32445045)     Exons: 5     NC_000006.12
• Gene summary(Entrez): HLA-DRA is one of the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha and a beta chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from ext
• OMIM: 142860

SNPs

rs3129878

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.32440958A>C
NC_000006.11   g.32408735A>C
NT_113891.3   g.3879082C>A
NT_113891.2   g.3879188C>A
NG_002392.2   g.5293C>A
NT_167248.2   g.3664005A>C
NT_167248.1   g.3669601A>C
NT_167245.2   g.3681261A>C
NT_167245.1   g.3686846A>C
NT_167249.2   g.3756099A>C

rs7194

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.32444703G>A
NC_000006.12   g.32444703G>C
NC_000006.11   g.32412480G>A
NC_000006.11   g.32412480G>C
NT_113891.3   g.3882792G>A
NT_113891.3   g.3882792G>C
NT_113891.2   g.3882898G>A
NT_113891.2   g.3882898G>C
NG_002392.2   g.9003G>A
NG_002392.2   g.9003G>

Protein Summary

• Protein general information: P01903  
  • Name: HLA class II histocompatibility antigen, DR alpha chain (MHC class II antigen DRA)
  • Length: 254  
  • Mass: 28,607
• Sequence:

  MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGR
  FASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWLRNG
  KPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLT
  VGLVGIIIGTIFIIKGVRKSNAAERRGPL

• Structural information:
  • Protein Domains: Ig-like (112-204)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003006  IPR003597   IPR011162  IPR014745  IPR001003  
  • Prosite: PS50835 PS00290
  • PDB: 1A6A 1AQD 1BX2 1D5M 1D5X 1D5Z 1D6E 1DLH 1FV1 1FYT 1H15 1HQR 1HXY 1J8H 1JWM 1JWS 1JWU 1KG0 1KLG 1KLU 1LO5 1PYW 1R5I 1SEB 1SJE 1SJH 1T5W 1T5X 1YMM 1ZGL 2FSE 2G9H 2IAM 2IAN 2ICW 2IPK 2OJE 2Q6W 2SEB 2WBJ 2XN9 3C5J 3L6F 3O6F 3PDO 3PGC 3PGD 3QXA 3QXD 3S4S 3S5L
  • PDBsum: 1A6A 1AQD 1BX2 1D5M 1D5X 1D5Z 1D6E 1DLH 1FV1 1FYT 1H15 1HQR 1HXY 1J8H 1JWM 1JWS 1JWU 1KG0 1KLG 1KLU 1LO5 1PYW 1R5I 1SEB 1SJE 1SJH 1T5W 1T5X 1YMM 1ZGL 2FSE 2G9H 2IAM 2IAN 2ICW 2IPK 2OJE 2Q6W 2SEB 2WBJ 2XN9 3C5J 3L6F 3O6F 3PDO 3PGC 3PGD 3QXA 3QXD 3S4S 3S5L
  • DIP: 6063
  • STRING: ENSP00000378786
• Other Databases: GeneCards:  HLA-DRA  Malacards:  HLA-DRA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological process
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological process
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological process
GO:0002504	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IDA	biological process
GO:0002506	polysaccharide assembly with MHC class II protein complex	IDA	biological process
GO:0005764	lysosome	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0006955	immune response	NAS	biological process
GO:0006955	immune response	NAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0016032	viral process	IEA	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0023026	MHC class II protein complex binding	IDA	molecular function
GO:0030658	transport vesicle membrane	TAS	cellular component
GO:0030658	transport vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular component
GO:0031295	T cell costimulation	TAS	biological process
GO:0031902	late endosome membrane	IDA	cellular component
GO:0031902	late endosome membrane	IDA	cellular component
GO:0032395	MHC class II receptor activity	NAS	molecular function
GO:0032395	MHC class II receptor activity	NAS	molecular function
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0042605	peptide antigen binding	IDA	molecular function
GO:0042605	peptide antigen binding	IDA	molecular function
GO:0042605	peptide antigen binding	IDA	molecular function
GO:0042605	peptide antigen binding	IDA	molecular function
GO:0042605	peptide antigen binding	IDA	molecular function
GO:0042613	MHC class II protein complex	IDA	cellular component
GO:0042613	MHC class II protein complex	IDA	cellular component
GO:0042613	MHC class II protein complex	IDA	cellular component
GO:0042613	MHC class II protein complex	IDA	cellular component
GO:0042613	MHC class II protein complex	IDA	cellular component
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0050890	cognition	IMP	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological process
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological process
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological process
GO:0002504	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IEA	biological process
GO:0002504	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IDA	biological process
GO:0002506	polysaccharide assembly with MHC class II protein complex	IDA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0006955	immune response	IEA	biological process
GO:0006955	immune response	NAS	biological process
GO:0006955	immune response	NAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0019882	antigen processing and presentation	IEA	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0023026	MHC class II protein complex binding	IDA	molecular function
GO:0030658	transport vesicle membrane	TAS	cellular component
GO:0030658	transport vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular component
GO:0031295	T cell costimulation	TAS	biological process
GO:0031902	late endosome membrane	IEA	cellular component
GO:0031902	late endosome membrane	IDA	cellular component
GO:0031902	late endosome membrane	IDA	cellular component
GO:0032395	MHC class II receptor activity	NAS	molecular function
GO:0032395	MHC class II receptor activity	NAS	molecular function
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0042605	peptide antigen binding	IDA	molecular function
GO:0042605	peptide antigen binding	IDA	molecular function
GO:0042605	peptide antigen binding	IDA	molecular function
GO:0042605	peptide antigen binding	IDA	molecular function
GO:0042605	peptide antigen binding	IDA	molecular function
GO:0042613	MHC class II protein complex	IEA	cellular component
GO:0042613	MHC class II protein complex	IEA	cellular component
GO:0042613	MHC class II protein complex	IDA	cellular component
GO:0042613	MHC class II protein complex	IDA	cellular component
GO:0042613	MHC class II protein complex	IDA	cellular component
GO:0042613	MHC class II protein complex	IDA	cellular component
GO:0042613	MHC class II protein complex	IDA	cellular component
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0050890	cognition	IMP	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological process
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological process
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological process
GO:0002504	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IDA	biological process
GO:0002506	polysaccharide assembly with MHC class II protein complex	IDA	biological process
GO:0005764	lysosome	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0006955	immune response	NAS	biological process
GO:0006955	immune response	NAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0023026	MHC class II protein complex binding	IDA	molecular function
GO:0030658	transport vesicle membrane	TAS	cellular component
GO:0030658	transport vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular component
GO:0031295	T cell costimulation	TAS	biological process
GO:0031902	late endosome membrane	IDA	cellular component
GO:0031902	late endosome membrane	IDA	cellular component
GO:0032395	MHC class II receptor activity	NAS	molecular function
GO:0032395	MHC class II receptor activity	NAS	molecular function
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0042605	peptide antigen binding	IDA	molecular function
GO:0042605	peptide antigen binding	IDA	molecular function
GO:0042605	peptide antigen binding	IDA	molecular function
GO:0042605	peptide antigen binding	IDA	molecular function
GO:0042605	peptide antigen binding	IDA	molecular function
GO:0042613	MHC class II protein complex	IDA	cellular component
GO:0042613	MHC class II protein complex	IDA	cellular component
GO:0042613	MHC class II protein complex	IDA	cellular component
GO:0042613	MHC class II protein complex	IDA	cellular component
GO:0042613	MHC class II protein complex	IDA	cellular component
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0050890	cognition	IMP	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00600	Sphingolipid metabolism
hsa00591	Linoleic acid metabolism
hsa00360	Phenylalanine metabolism
hsa00603	Glycosphingolipid biosynthesis - globo and isoglobo series
hsa00740	Riboflavin metabolism
hsa00790	Folate biosynthesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa04015	Rap1 signaling pathway
hsa04015	Rap1 signaling pathway
hsa04015	Rap1 signaling pathway
hsa04015	Rap1 signaling pathway
hsa04015	Rap1 signaling pathway
hsa04010	MAPK signaling pathway
hsa04010	MAPK signaling pathway
hsa04010	MAPK signaling pathway
hsa04010	MAPK signaling pathway
hsa04310	Wnt signaling pathway
hsa04310	Wnt signaling pathway
hsa04350	TGF-beta signaling pathway
hsa04390	Hippo signaling pathway
hsa04370	VEGF signaling pathway
hsa04371	Apelin signaling pathway
hsa04630	JAK-STAT signaling pathway
hsa04630	JAK-STAT signaling pathway
hsa04514	Cell adhesion molecules
hsa04145	Phagosome
hsa04640	Hematopoietic cell lineage
hsa04612	Antigen processing and presentation
hsa04658	Th1 and Th2 cell differentiation
hsa04659	Th17 cell differentiation
hsa04672	Intestinal immune network for IgA production
hsa05310	Asthma
hsa05322	Systemic lupus erythematosus
hsa05323	Rheumatoid arthritis
hsa05320	Autoimmune thyroid disease
hsa05321	Inflammatory bowel disease
hsa05330	Allograft rejection
hsa05332	Graft-versus-host disease
hsa05416	Viral myocarditis
hsa04940	Type I diabetes mellitus
hsa05150	Staphylococcus aureus infection
hsa05152	Tuberculosis
hsa05166	Human T-cell leukemia virus 1 infection
hsa05164	Influenza A
hsa05168	Herpes simplex virus 1 infection
hsa05169	Epstein-Barr virus infection
hsa05145	Toxoplasmosis
hsa05140	Leishmaniasis

Diseases

Associated diseases	References
Sarcoidosis	GAD: 11320565
Arthritis	GAD: 11361223
Asthma	GAD: 19247692
Celiac disease	GAD: 3014038
Scleroderma	GAD: 21779181
Ulcerative colitis	GAD: 12073071
Rheumatoid arthritis	GAD: 11361223
Systemic lupus erythematosus (SLE)	GAD: 11324494
Crohn's disease	GAD: 11742191
Diabetes	GAD: 11260509
Spondylarthropathies	GAD: 12117677
Dermatomyositis	GAD: 18846964
Stroke	GAD: 12373032
Uveomeningoencephalitic syndrome	GAD: 19452015
Myasthenia gravis	GAD: 15301866
Alzheimer's disease	GAD: 19204726
Parkinson disease	GAD: 20711177
Azoospermia	GAD: 22541561
Female infertility	INFBASE: 20734673
Recurrent pregnancy loss (RPL)	INFBASE: 8104478
Unexplained infertility	INFBASE: 10668156
Non obstructive azoospermia	MIK: 25505198
Diffuse panbonchiolitis	GAD: 18846964
Latex-fruit syndrome	GAD: 15536412
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Non-obstructive azoospermia	MIK: 27597543
Spermatogenic defects	MIK: 31037746
Unexplained infertility	MIK: 10668156

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
10668156	Unexplained infertility			76 couples (52 couples with unexplained infertility, 15 infertile and 9 fertile couples)	Male infertility, Female infertility
25505198	Non-obstructive azoospermia (NOA)	(HLA-DRA rs3129878, PRMT6 rs12097821, SOX5 rs10842262, and PEX10 rs2477686)	Han Chi nese	1177 (545 patients with idiopathic NOA, 632 controls with normozoospermia)	Male infertility	HLA-DR SOX5
27597543	Non-obstructive azoospermia	rs3129878, rs7194	Han Chi nese	1213 (603 non-obstructive azoospermia (NOA) patients, 610 controls)	Male infertility	GWAS
30502936	Non-obstructive azoospermia	rs7194	Han Chi nese	2638 (981 men with NOA and 1,657 normal fertile male controls)	Male infertility	GWAS
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray