Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 3119
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol HLA-DQB1   Gene   UCSC   Ensembl
Aliases CELIAC1, HLA-DQB, IDDM1
Gene name major histocompatibility complex, class II, DQ beta 1
Alternate names HLA class II histocompatibility antigen, DQ beta 1 chain, MHC class II DQ beta chain, MHC class II HLA-DQ beta glycoprotein, MHC class II antigen DQB1, MHC class II antigen HLA-DQ-beta-1,
Gene location 6p21.32 (32666688: 32659463)     Exons: 6     NC_000006.12
Gene summary(Entrez) HLA-DQB1 belongs to the HLA class II beta chain paralogs. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides deriv
OMIM 604305

Protein Summary
Protein general information P01920  

Name: HLA class II histocompatibility antigen, DQ beta 1 chain (MHC class II antigen DQB1)

Length: 261  Mass: 29,991

Tissue specificity: Testis and sperm specific.

Sequence MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSD
VEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCS
VTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSE
SAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH
Structural information
Protein Domains
 Ig-like (129-217)
Interpro:  IPR007110  IPR036179  IPR013783  IPR003006  IPR003597  
IPR011162  IPR014745  IPR000353  
Prosite:   PS50835 PS00290

PDB:  		 1JK8 1NBN 1S9V 1UVQ 2NNA 4GG6 4OZF 4OZG 4OZH 4OZI
PDBsum:   1JK8 1NBN 1S9V 1UVQ 2NNA 4GG6 4OZF 4OZG 4OZH 4OZI
MINT:  
Other Databases GeneCards:  HLA-DQB1  Malacards:  HLA-DQB1

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0000139 Golgi membrane
 TAS cellular component
GO:0000139 Golgi membrane
 TAS cellular component
GO:0002381 immunoglobulin production
involved in immunoglobul
in mediated immune respon
se
 IDA biological process
GO:0002455 humoral immune response m
ediated by circulating im
munoglobulin
 IDA biological process
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0006955 immune response
 NAS biological process
GO:0010008 endosome membrane
 IEA cellular component
GO:0012507 ER to Golgi transport ves
icle membrane
 TAS cellular component
GO:0012507 ER to Golgi transport ves
icle membrane
 TAS cellular component
GO:0016020 membrane
 IDA cellular component
GO:0016020 membrane
 NAS cellular component
GO:0019886 antigen processing and pr
esentation of exogenous p
eptide antigen via MHC cl
ass II
 TAS biological process
GO:0030658 transport vesicle membran
e
 TAS cellular component
GO:0030658 transport vesicle membran
e
 TAS cellular component
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0030669 clathrin-coated endocytic
vesicle membrane
 TAS cellular component
GO:0030669 clathrin-coated endocytic
vesicle membrane
 TAS cellular component
GO:0031295 T cell costimulation
 TAS biological process
GO:0032395 MHC class II receptor act
ivity
 NAS molecular function
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0042605 peptide antigen binding
 ISS molecular function
GO:0042613 MHC class II protein comp
lex
 ISS cellular component
GO:0050852 T cell receptor signaling
pathway
 TAS biological process
GO:0060333 interferon-gamma-mediated
signaling pathway
 TAS biological process
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0000139 Golgi membrane
 TAS cellular component
GO:0000139 Golgi membrane
 TAS cellular component
GO:0002376 immune system process
 IEA biological process
GO:0002381 immunoglobulin production
involved in immunoglobul
in mediated immune respon
se
 IDA biological process
GO:0002455 humoral immune response m
ediated by circulating im
munoglobulin
 IDA biological process
GO:0002504 antigen processing and pr
esentation of peptide or
polysaccharide antigen vi
a MHC class II
 IEA biological process
GO:0005764 lysosome
 IEA cellular component
GO:0005765 lysosomal membrane
 IEA cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005768 endosome
 IEA cellular component
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0005789 endoplasmic reticulum mem
brane
 IEA cellular component
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0006955 immune response
 IEA biological process
GO:0006955 immune response
 NAS biological process
GO:0010008 endosome membrane
 IEA cellular component
GO:0012507 ER to Golgi transport ves
icle membrane
 TAS cellular component
GO:0012507 ER to Golgi transport ves
icle membrane
 TAS cellular component
GO:0016020 membrane
 IEA cellular component
GO:0016020 membrane
 IEA cellular component
GO:0016020 membrane
 IDA cellular component
GO:0016020 membrane
 NAS cellular component
GO:0016021 integral component of mem
brane
 IEA cellular component
GO:0019882 antigen processing and pr
esentation
 IEA biological process
GO:0019886 antigen processing and pr
esentation of exogenous p
eptide antigen via MHC cl
ass II
 TAS biological process
GO:0030658 transport vesicle membran
e
 TAS cellular component
GO:0030658 transport vesicle membran
e
 TAS cellular component
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0030669 clathrin-coated endocytic
vesicle membrane
 TAS cellular component
GO:0030669 clathrin-coated endocytic
vesicle membrane
 TAS cellular component
GO:0031295 T cell costimulation
 TAS biological process
GO:0032395 MHC class II receptor act
ivity
 NAS molecular function
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0042605 peptide antigen binding
 ISS molecular function
GO:0042613 MHC class II protein comp
lex
 IEA cellular component
GO:0042613 MHC class II protein comp
lex
 IEA cellular component
GO:0042613 MHC class II protein comp
lex
 ISS cellular component
GO:0050852 T cell receptor signaling
pathway
 TAS biological process
GO:0060333 interferon-gamma-mediated
signaling pathway
 TAS biological process
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0000139 Golgi membrane
 TAS cellular component
GO:0000139 Golgi membrane
 TAS cellular component
GO:0002381 immunoglobulin production
involved in immunoglobul
in mediated immune respon
se
 IDA biological process
GO:0002455 humoral immune response m
ediated by circulating im
munoglobulin
 IDA biological process
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0006955 immune response
 NAS biological process
GO:0012507 ER to Golgi transport ves
icle membrane
 TAS cellular component
GO:0012507 ER to Golgi transport ves
icle membrane
 TAS cellular component
GO:0016020 membrane
 IDA cellular component
GO:0016020 membrane
 NAS cellular component
GO:0019886 antigen processing and pr
esentation of exogenous p
eptide antigen via MHC cl
ass II
 TAS biological process
GO:0030658 transport vesicle membran
e
 TAS cellular component
GO:0030658 transport vesicle membran
e
 TAS cellular component
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0030669 clathrin-coated endocytic
vesicle membrane
 TAS cellular component
GO:0030669 clathrin-coated endocytic
vesicle membrane
 TAS cellular component
GO:0031295 T cell costimulation
 TAS biological process
GO:0032395 MHC class II receptor act
ivity
 NAS molecular function
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0042605 peptide antigen binding
 ISS molecular function
GO:0042613 MHC class II protein comp
lex
 ISS cellular component
GO:0050852 T cell receptor signaling
pathway
 TAS biological process
GO:0060333 interferon-gamma-mediated
signaling pathway
 TAS biological process
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa00600Sphingolipid metabolism
hsa00591Linoleic acid metabolism
hsa00360Phenylalanine metabolism
hsa00601Glycosphingolipid biosynthesis - lacto and neolacto series
hsa00730Thiamine metabolism
hsa00770Pantothenate and CoA biosynthesis
hsa00980Metabolism of xenobiotics by cytochrome P450
hsa04015Rap1 signaling pathway
hsa04015Rap1 signaling pathway
hsa04015Rap1 signaling pathway
hsa04015Rap1 signaling pathway
hsa04015Rap1 signaling pathway
hsa04010MAPK signaling pathway
hsa04010MAPK signaling pathway
hsa04010MAPK signaling pathway
hsa04010MAPK signaling pathway
hsa04310Wnt signaling pathway
hsa04310Wnt signaling pathway
hsa04340Hedgehog signaling pathway
hsa04390Hippo signaling pathway
hsa04392Hippo signaling pathway - multiple species
hsa04371Apelin signaling pathway
hsa04630JAK-STAT signaling pathway
hsa04630JAK-STAT signaling pathway
hsa04514Cell adhesion molecules
hsa04145Phagosome
hsa04640Hematopoietic cell lineage
hsa04612Antigen processing and presentation
hsa04658Th1 and Th2 cell differentiation
hsa04659Th17 cell differentiation
hsa04672Intestinal immune network for IgA production
hsa05310Asthma
hsa05322Systemic lupus erythematosus
hsa05323Rheumatoid arthritis
hsa05320Autoimmune thyroid disease
hsa05321Inflammatory bowel disease
hsa05330Allograft rejection
hsa05332Graft-versus-host disease
hsa05416Viral myocarditis
hsa04940Type I diabetes mellitus
hsa05150Staphylococcus aureus infection
hsa05152Tuberculosis
hsa05166Human T-cell leukemia virus 1 infection
hsa05164Influenza A
hsa05168Herpes simplex virus 1 infection
hsa05169Epstein-Barr virus infection
hsa05145Toxoplasmosis
hsa05140Leishmaniasis

Diseases

Expand All | Collapse All
Associated diseases References
Cancer GAD: 21533074
Cancer (brain) GAD: 19487887
Cancer (breast) GAD: 11027344
Cancer (cervical) GAD: 16386646
Cancer (colorectal) GAD: 19251712
Cancer (gastric) GAD: 8690208
Cancer (gastrointestinal) GAD: 11972882
Cancer (glaucoma) GAD: 21031025
Cancer (head and neck) GAD: 16573562
Cancer (Hematologic) GAD: 19589487
Cancer (Hepatocellular) GAD: 11318984
Cancer (Kaposi's sarcoma) GAD: 15902698
Cancer (kidney) GAD: 12771724
Cancer (leukemia) GAD: 15202948
Cancer (liver) GAD: 15556690
Cancer (lung) GAD: 15652424
Cancer (lymphoma) GAD: 15361135
Cancer (melanoma) GAD: 16101833
Cancer (meningioma) GAD: 14693734
Cancer (nasopharyngeal) GAD: 19714482
Cancer (ovarian) GAD: 15935893
Cancer (Squamous cell) GAD: 18535809
Cancer (stomach) GAD: 17203517
Cancer (testicular) GAD: 16720210
Cancer (thyroid) GAD: 16430717
Colorectal cancer GAD: 19251712
Paraneoplastic syndromes GAD: 20547426
Aortic aneurysm GAD: 16879749
Atherosclerosis GAD: 15825968
Brugada syndrome GAD: 17124999
Cardiovascular disease GAD: 16225776
Hypertension GAD: 21091360
Thrombosis GAD: 19922436
Dilated cardiomyopathy KEGG: H00294
Neuropathy GAD: 16053028
Liver disease GAD: 20639880
Liver disease GAD: 15185301
Primary biliary cirrhosis GAD: 19458352
Hashimoto disease GAD: 18599937
Polyendocrinopathies GAD: 18390988
Hashimoto disease KEGG: H00081
Graves disease KEGG: H00082
Macular degeneration GAD: 15851575
Eye diseases GAD: 18385790
Myopia GAD: 11864433
Retinopathy GAD: 15019597
Trachoma GAD: 18824733
Uveitis GAD: 16019679
Anemia GAD: 18689790
Sickle cell anemia GAD: 11872237
Hemophilia GAD: 15357778
Sarcoidosis GAD: 14508706
Thalassemia GAD: 12513847
Idiopathic thrombocytopenic purpura GAD: 20141578
Addison's disease GAD: 12072047
Adrenal insufficiency GAD: 19890026
Allergy GAD: 15853900
Alopecia areata GAD: 17062033
Alveolitis GAD: 16362107
Ankylosing spondylitis GAD: 12021150
Antiphospholipid syndrome GAD: 11246532
Arthritis GAD: 11981324
Asthma GAD: 15853903
Atopy GAD: 15969672
Autoimmune diseases GAD: 11678832
Autoimmune diseases GAD: 12734793
Autoimmune diseases GAD: 11678832
Behcet's disease GAD: 19038507
Celiac disease GAD: 11181188
Cholangitis GAD: 17257319
Celiac disease GAD: 19474744
Crohn's disease GAD: 11423176
Cutaneous neonatal lupus GAD: 15334474
Inflammatory bowel disease GAD: 12656131
Pancreatitis GAD: 17119950
Juvenile arthritis GAD: 12364641
Sjogren's syndrome GAD: 11752507
Multiple sclerosis GAD: 15471368
Ulcerative colitis GAD: 17301827
Rheumatoid arthritis GAD: 15120191
Scleroderma GAD: 11393660
Periodontitis GAD: 12296785
Inflammatory myopathies GAD: 11972875
Psoriasis GAD: 15245541
Systemic lupus erythematosus (SLE) GAD: 11997714
Biliary atresia GAD: 12100571
Cholelithiasis GAD: 18554163
Diabetes GAD: 12445315
Diabetes KEGG: H00408
Knee osteoarthritis GAD: 20305777
Osteoarthritis GAD: 12594107
Osteoporosis GAD: 17498269
Myopathy GAD: 12124873
Myositis GAD: 19690132
Polymyositis GAD: 12170471
Dermatomyositis GAD: 17586554
Rheumatic diseases GAD: 14602216
Dystonia GAD: 19523767
Encephalomyelitis GAD: 19722042
Sleep disorders GAD: 17162989
Paraparesis GAD: 20851016
Primary IgA nephropathy GAD: 1968992
Creutzfeldt-Jakob disease OMIM: 604305
Stroke GAD: 12373032
Polyangiitis GAD: 16208405
Vogt-Koyanagi-Harada syndrome GAD: 15603876
Myasthenia gravis GAD: 14700596
Guillain-Barre syndrome GAD: 11776098
Sporadic inclusion body myositis GAD: 15496200
Arthrofibrosis GAD: 15122136
Beryllium disease GAD: 14662898
Chronic fatigue syndrome GAD: 16049290
Cirrhosis GAD: 12089669
Meniere disease GAD: 17592398
Sensorineural hearing loss GAD: 16303674
Bipolar disorder GAD: 12109964
Schizophrenia GAD: 11920855
Psychological disorders GAD: 20606439
Abortion GAD: 20307907
Azoospermia GAD: 12366783
Endometriosis GAD: 12721173
Hypothyroidism GAD: 17588142
Pelvic inflammatory disease (PID) GAD: 15107633
Preeclampsia GAD: 12443029
Recurrent pregnancy loss (RPL) GAD: 15304010
Recurrent pregnancy loss (RPL) GAD: 15336778
Tubal factor infertility GAD: 12151439
Female infertility INFBASE: 10708242
Primary ovarian insufficiency (POI) INFBASE: 21811055
Premature ovarian failure (POF) INFBASE: 10084595
Male factor infertility MIK: 11935327
Non obstructive azoospermia MIK: 12366783
Spermatogenesis defects MIK: 10611211
Spermatogenesis defects MIK: 14718045
Silicosis GAD: 15703453
Pulmonary fibrosis GAD: 16133177
Wegener granulomatosis GAD: 15708894
Nasal polyposis GAD: 16890076
Rhinitis GAD: 22036096
Goodpasture's disease GAD: 15199166
Dermatitis GAD: 16836882
Keloids GAD: 18562179
Warts GAD: 15257408
Pityriasis rosea GAD: 16405603
Systemic sclerosis GAD: 19596691
Vitiligo GAD: 16409268
Epidermal Necrolysis GAD: 19668019
Pemphigus vulgaris GAD: 16261886
Urticaria GAD: 18955792
Early onset periodontitis GAD: 8884646
Bronchiectasis GAD: 18241227
Calcinosis GAD: 19479859
Schistosomiasis mansoni GAD: 18495081
Thryoiditis GAD: 15305234
Viral myocarditis GAD: H00295
Vulval lichen sclerosus GAD: 16297186
Vulvovaginal gingival syndrome GAD: 16781300
Renal disease GAD: 11082516
Nephropathy GAD: 12651073
Hemoglobinuria GAD: 18396213
Nephrotic syndrome GAD: 17180363
Cataract GAD: 17605936
Male infertility MIK: 11111869
Non-obstructive azoopermia MIK: 12366783
Spermatogenic defects MIK: 14718045

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
12366783 Non-obstru
ctive azoo
permia
 DRB1*1302, DQB1*0604

Male infertility HLA-DR/DQ
 Show abstract
10611211 Spermatoge
nesis and
male gamet
e function

Male infertility
Show abstract
14718045 Severe spe
rmatogenic
impairmen
t
 HLA-DRB1*1302-DQB1*0604 allele 

Male infertility HLA-DRB1
HLA- DQB1
 Show abstract
11935327 Non-obstru
ctive azoo
spermia
 HLA-DRB1*1302, HLA-A33 and -B44 Japanes
e
Male infertility HLA-DRB1*1302
HLA-A33
-B44
 Show abstract
11111869 Male infer
tility
18 (8 infertile
, 10 fertile)
 Male infertility HLA II
 Show abstract
17327269 Teratozoos
permia
13 (5 controls,
8 cases)
 Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract