Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 3115
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol HLA-DPB1   Gene   UCSC   Ensembl
Aliases DPB1, HLA-DP, HLA-DP1B, HLA-DPB
Gene name major histocompatibility complex, class II, DP beta 1
Alternate names HLA class II histocompatibility antigen, DP beta 1 chain, HLA class II histocompatibility antigen, DP(W4) beta chain, HLA-DP histocompatibility type, beta-1 subunit, MHC HLA DPB1, MHC class II HLA-DP-beta-1, MHC class II antigen DPB1,
Gene location 6p21.32 (33075925: 33089695)     Exons: 6     NC_000006.12
Gene summary(Entrez) HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides deri
OMIM 142858

Protein Summary
Protein general information P04440  

Name: HLA class II histocompatibility antigen, DP beta 1 chain (HLA class II histocompatibility antigen, DP(W4) beta chain) (MHC class II antigen DPB1)

Length: 258  Mass: 29159

Sequence MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFR
AVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFY
PGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSK
TLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA
Structural information
Protein Domains
 (124..21-)
(/note="Ig-like-C1-type")
Interpro:  IPR007110  IPR036179  IPR013783  IPR003006  IPR003597  
IPR011162  IPR014745  IPR000353  
Prosite:   PS50835 PS00290

PDB:  		 3LQZ 4P4K 4P4R 4P57 4P5K 4P5M
PDBsum:   3LQZ 4P4K 4P4R 4P57 4P5K 4P5M
MINT:  
STRING:   ENSP00000408146
Other Databases GeneCards:  HLA-DPB1  Malacards:  HLA-DPB1

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0000139 Golgi membrane
 TAS cellular component
GO:0000139 Golgi membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0009986 cell surface
 IMP cellular component
GO:0010008 endosome membrane
 IEA cellular component
GO:0012507 ER to Golgi transport ves
icle membrane
 TAS cellular component
GO:0012507 ER to Golgi transport ves
icle membrane
 TAS cellular component
GO:0016020 membrane
 IDA cellular component
GO:0019886 antigen processing and pr
esentation of exogenous p
eptide antigen via MHC cl
ass II
 IMP biological process
GO:0019886 antigen processing and pr
esentation of exogenous p
eptide antigen via MHC cl
ass II
 TAS biological process
GO:0030658 transport vesicle membran
e
 TAS cellular component
GO:0030658 transport vesicle membran
e
 TAS cellular component
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0030669 clathrin-coated endocytic
vesicle membrane
 TAS cellular component
GO:0030669 clathrin-coated endocytic
vesicle membrane
 TAS cellular component
GO:0031295 T cell costimulation
 TAS biological process
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032729 positive regulation of in
terferon-gamma production
 IMP biological process
GO:0042102 positive regulation of T
cell proliferation
 IMP biological process
GO:0042605 peptide antigen binding
 IDA molecular function
GO:0042613 MHC class II protein comp
lex
 IDA cellular component
GO:0050852 T cell receptor signaling
pathway
 TAS biological process
GO:0050870 positive regulation of T
cell activation
 IMP biological process
GO:0060333 interferon-gamma-mediated
signaling pathway
 TAS biological process
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0000139 Golgi membrane
 TAS cellular component
GO:0000139 Golgi membrane
 TAS cellular component
GO:0002376 immune system process
 IEA biological process
GO:0002504 antigen processing and pr
esentation of peptide or
polysaccharide antigen vi
a MHC class II
 IEA biological process
GO:0005764 lysosome
 IEA cellular component
GO:0005765 lysosomal membrane
 IEA cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005768 endosome
 IEA cellular component
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0005789 endoplasmic reticulum mem
brane
 IEA cellular component
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0006955 immune response
 IEA biological process
GO:0009986 cell surface
 IMP cellular component
GO:0010008 endosome membrane
 IEA cellular component
GO:0012507 ER to Golgi transport ves
icle membrane
 TAS cellular component
GO:0012507 ER to Golgi transport ves
icle membrane
 TAS cellular component
GO:0016020 membrane
 IEA cellular component
GO:0016020 membrane
 IEA cellular component
GO:0016020 membrane
 IDA cellular component
GO:0016021 integral component of mem
brane
 IEA cellular component
GO:0019882 antigen processing and pr
esentation
 IEA biological process
GO:0019886 antigen processing and pr
esentation of exogenous p
eptide antigen via MHC cl
ass II
 IMP biological process
GO:0019886 antigen processing and pr
esentation of exogenous p
eptide antigen via MHC cl
ass II
 TAS biological process
GO:0030658 transport vesicle membran
e
 TAS cellular component
GO:0030658 transport vesicle membran
e
 TAS cellular component
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0030669 clathrin-coated endocytic
vesicle membrane
 TAS cellular component
GO:0030669 clathrin-coated endocytic
vesicle membrane
 TAS cellular component
GO:0031295 T cell costimulation
 TAS biological process
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032729 positive regulation of in
terferon-gamma production
 IMP biological process
GO:0042102 positive regulation of T
cell proliferation
 IMP biological process
GO:0042605 peptide antigen binding
 IDA molecular function
GO:0042613 MHC class II protein comp
lex
 IEA cellular component
GO:0042613 MHC class II protein comp
lex
 IEA cellular component
GO:0042613 MHC class II protein comp
lex
 IDA cellular component
GO:0050852 T cell receptor signaling
pathway
 TAS biological process
GO:0050870 positive regulation of T
cell activation
 IMP biological process
GO:0060333 interferon-gamma-mediated
signaling pathway
 TAS biological process
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0000139 Golgi membrane
 TAS cellular component
GO:0000139 Golgi membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0009986 cell surface
 IMP cellular component
GO:0012507 ER to Golgi transport ves
icle membrane
 TAS cellular component
GO:0012507 ER to Golgi transport ves
icle membrane
 TAS cellular component
GO:0016020 membrane
 IDA cellular component
GO:0019886 antigen processing and pr
esentation of exogenous p
eptide antigen via MHC cl
ass II
 IMP biological process
GO:0019886 antigen processing and pr
esentation of exogenous p
eptide antigen via MHC cl
ass II
 TAS biological process
GO:0030658 transport vesicle membran
e
 TAS cellular component
GO:0030658 transport vesicle membran
e
 TAS cellular component
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0030669 clathrin-coated endocytic
vesicle membrane
 TAS cellular component
GO:0030669 clathrin-coated endocytic
vesicle membrane
 TAS cellular component
GO:0031295 T cell costimulation
 TAS biological process
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032729 positive regulation of in
terferon-gamma production
 IMP biological process
GO:0042102 positive regulation of T
cell proliferation
 IMP biological process
GO:0042605 peptide antigen binding
 IDA molecular function
GO:0042613 MHC class II protein comp
lex
 IDA cellular component
GO:0050852 T cell receptor signaling
pathway
 TAS biological process
GO:0050870 positive regulation of T
cell activation
 IMP biological process
GO:0060333 interferon-gamma-mediated
signaling pathway
 TAS biological process
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0019882 antigen processing and pr
esentation
 IEA biological process
GO:0006955 immune response
 IEA biological process
GO:0016020 membrane
 IEA cellular component
GO:0042613 MHC class II protein comp
lex
 IEA cellular component
GO:0005768 endosome
 IEA cellular component
GO:0005764 lysosome
 IEA cellular component
GO:0002504 antigen processing and pr
esentation of peptide or
polysaccharide antigen vi
a MHC class II
 IEA biological process
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0002376 immune system process
 IEA biological process
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0042613 MHC class II protein comp
lex
 IEA cellular component
GO:0002250 adaptive immune response
 IEA biological process
GO:0005886 plasma membrane
 IEA cellular component
GO:0016021 integral component of mem
brane
 IEA cellular component
GO:0016020 membrane
 IEA cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0019886 antigen processing and pr
esentation of exogenous p
eptide antigen via MHC cl
ass II
 TAS biological process
GO:0030658 transport vesicle membran
e
 TAS cellular component
GO:0030658 transport vesicle membran
e
 TAS cellular component
GO:0030669 clathrin-coated endocytic
vesicle membrane
 TAS cellular component
GO:0030669 clathrin-coated endocytic
vesicle membrane
 TAS cellular component
GO:0050852 T cell receptor signaling
pathway
 TAS biological process
GO:0060333 interferon-gamma-mediated
signaling pathway
 TAS biological process
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
 TAS cellular component
GO:0000139 Golgi membrane
 TAS cellular component
GO:0000139 Golgi membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0005765 lysosomal membrane
 TAS cellular component
GO:0012507 ER to Golgi transport ves
icle membrane
 TAS cellular component
GO:0012507 ER to Golgi transport ves
icle membrane
 TAS cellular component
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0032588 trans-Golgi network membr
ane
 TAS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0005789 endoplasmic reticulum mem
brane
 IEA cellular component
GO:0005765 lysosomal membrane
 IEA cellular component
GO:0010008 endosome membrane
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0042605 peptide antigen binding
 IDA molecular function
GO:0042613 MHC class II protein comp
lex
 IDA cellular component
GO:0050870 positive regulation of T
cell activation
 IMP biological process
GO:0042102 positive regulation of T
cell proliferation
 IMP biological process
GO:0032729 positive regulation of in
terferon-gamma production
 IMP biological process
GO:0016020 membrane
 HDA cellular component
GO:0019886 antigen processing and pr
esentation of exogenous p
eptide antigen via MHC cl
ass II
 IMP biological process
GO:0009986 cell surface
 IMP cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05168Herpes simplex virus 1 infection
hsa05166Human T-cell leukemia virus 1 infection
hsa05169Epstein-Barr virus infection
hsa05152Tuberculosis
hsa04145Phagosome
hsa05164Influenza A
hsa04514Cell adhesion molecules
hsa05322Systemic lupus erythematosus
hsa04659Th17 cell differentiation
hsa05145Toxoplasmosis
hsa04658Th1 and Th2 cell differentiation
hsa05150Staphylococcus aureus infection
hsa04640Hematopoietic cell lineage
hsa05323Rheumatoid arthritis
hsa05140Leishmaniasis
hsa04612Antigen processing and presentation
hsa05321Inflammatory bowel disease
hsa05416Viral myocarditis
hsa04672Intestinal immune network for IgA production
hsa05320Autoimmune thyroid disease
hsa04940Type I diabetes mellitus
hsa05310Asthma
hsa05332Graft-versus-host disease
hsa05330Allograft rejection
hsa00565Ether lipid metabolism
hsa00590Arachidonic acid metabolism
hsa00350Tyrosine metabolism
hsa00531Glycosaminoglycan degradation
hsa00511Other glycan degradation
hsa00760Nicotinate and nicotinamide metabolism
hsa00980Metabolism of xenobiotics by cytochrome P450
hsa04015Rap1 signaling pathway
hsa04015Rap1 signaling pathway
hsa04015Rap1 signaling pathway
hsa04015Rap1 signaling pathway
hsa04015Rap1 signaling pathway
hsa04010MAPK signaling pathway
hsa04010MAPK signaling pathway
hsa04010MAPK signaling pathway
hsa04010MAPK signaling pathway
hsa04310Wnt signaling pathway
hsa04310Wnt signaling pathway
hsa04340Hedgehog signaling pathway
hsa04390Hippo signaling pathway
hsa04392Hippo signaling pathway - multiple species
hsa04371Apelin signaling pathway
hsa04630JAK-STAT signaling pathway
hsa04630JAK-STAT signaling pathway
hsa04514Cell adhesion molecules
hsa04145Phagosome
hsa04640Hematopoietic cell lineage
hsa04612Antigen processing and presentation
hsa04658Th1 and Th2 cell differentiation
hsa04659Th17 cell differentiation
hsa04672Intestinal immune network for IgA production
hsa05310Asthma
hsa05322Systemic lupus erythematosus
hsa05323Rheumatoid arthritis
hsa05320Autoimmune thyroid disease
hsa05321Inflammatory bowel disease
hsa05330Allograft rejection
hsa05332Graft-versus-host disease
hsa05416Viral myocarditis
hsa04940Type I diabetes mellitus
hsa05150Staphylococcus aureus infection
hsa05152Tuberculosis
hsa05166Human T-cell leukemia virus 1 infection
hsa05164Influenza A
hsa05168Herpes simplex virus 1 infection
hsa05169Epstein-Barr virus infection
hsa05145Toxoplasmosis
hsa05140Leishmaniasis

Diseases

Expand All | Collapse All
Associated diseases References
Cancer GAD: 19589487
Cancer (Hematologic) GAD: 19589487
Cancer (leukemia) GAD: 17317585
Cancer (nasopharyngeal) GAD: 12464650
Cancer (cervical) GAD: 16386646
Cancer (Hepatocellular) GAD: 11318984
Cancer (lymphoma) GAD: 15361135
Cancer (breast) GAD: 11027344
Cardiovascular disease GAD: 17060025
Hypertension GAD: 19165231
Dilated cardiomyopathy KEGG: H00294
Antiphospholipid syndrome GAD: 12892399
Primary biliary cirrhosis GAD: 7843712
Graves disease GAD: 20300120
Retinopathy GAD: 12694588
Sarcoidosis GAD: 14508706
Hemophilia GAD: 18958335
Hodgkin disease GAD: 11401923
Scleroderma GAD: 11929590
Asthma GAD: 15784113
Atopy GAD: 15969672
Celiac disease GAD: 12878363
Asthma GAD: 1774196
Celiac disease GAD: 1971269
Scleroderma GAD: 11393660
Juvenile arthritis GAD: 15304007
Juvenile arthritis GAD: 15703957
Multiple sclerosis GAD: 16096810
Juvenile arthritis GAD: 12195624
Multiple sclerosis GAD: 18952831
Rheumatoid arthritis GAD: 19950296
Scleroderma GAD: 11393660
Rheumatoid arthritis GAD: 19950296
Multiple sclerosis GAD: 16096810
Systemic lupus erythematosus (SLE) GAD: 18569076
Systemic lupus erythematosus (SLE) GAD: 18569076
Allergy GAD: 12144625
Biliary atresia GAD: 12100571
Diabetes GAD: 11532022
Biliary atresia GAD: 12100571
Arthritis GAD: 20191588
Beryllium disease OMIM: 142858
Endometriosis GAD: 12721173
Endometriosis GAD: 12390706
Endometriosis INFBASE: 12390706
Unexplained infertility INFBASE: 7627354
Male factor infertility MIK: 23934009
Non obstructive azoospermia MIK: 23934009
Endometriosis GAD: 12721173
Silicosis GAD: 15703453
Pulmonary hypertension GAD: 15640334
Pulmonary hypertension GAD: 15640334
Wegener granulomatosis GAD: 17967832
Systemic sclerosis GAD: 19596691
Systemic sclerosis GAD: 19596691
Systemic sclerosis KEGG: H01492
Nephropathy GAD: 12651073
Nephropathy GAD: 12651073
Dilated cardiomyopathy KEGG:H00294
Systemic sclerosis KEGG:H01492
Dilated cardiomyopathy KEGG:H00294
Systemic sclerosis KEGG:H01492
Asthma PMID:21814517
Chronic obstructive pulmonary disease PMID:21423603
Lung disease PMID:21186201
Allergic asthma PMID:28380482
type 1 diabetes mellitus PMID:7576003
Non-obstructive azoopermia MIK: 23934009
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
23934009 Non-obstru
ctive azoo
spermia
 HLA-DPB1*04:01, rs498422, rs3129878, Japanes
e
 987 (443 patien
ts and 544 fert
ile males )
 Male infertility
Show abstract
23934009 Non-obstru
ctive azoo
permia
 HLA-DPB1*04:01 Japanes
e
 1342 (355 NOA,
443 patients an
d 544 fertile m
ales )
 Male infertility HLA-A
-B
-C
-DRB1
-DQB1
and -DPB1
 Show abstract
23934009 Non-obstru
ctive azoo
spermia
 rs498422, rs3129878, (HLA-A, -B, -C, -DRB1, -DQB1, and -DPB1)
1342 (355 NOA,
443 patients an
d 544 fertile m
ales)
 Male infertility
Show abstract
17327269 Teratozoos
permia
13 (5 controls,
8 cases)
 Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
25753583 Unexplaine
d infertil
ity
46 (17 fertile
men, 29 male pa
tients)
 Male infertility Microarray
 Show abstract
31037746 Spermatoge
nic defect
s
16 (1 control,
15 cases)
 Male infertility GSE6023 analyzed using GEO2R
 Show abstract