• Gene id: 3113

Gene Summary

• Gene Symbol: HLA-DPA1   Gene   UCSC   Ensembl
• Aliases: DP(W3), DP(W4), DPA1, HLA-DP1A, HLA-DPB1, HLADP, HLASB, PLT1
• Gene name: major histocompatibility complex, class II, DP alpha 1
• Alternate names: HLA class II histocompatibility antigen, DP alpha 1 chain, HLA DPA1, HLA-DPA1*01:03:01:New, HLA-DPA1*02:01:01:NEW, HLA-SB alpha chain, MHC class II DP alpha chain, MHC class II DP3-alpha, MHC class II HLA-DPA1 antigen,
• Gene location: 6p21.32 (33080747: 33064568)     Exons: 6     NC_000006.12
• Gene summary(Entrez): HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides de
• OMIM: 616305

Protein Summary

• Protein general information: P20036  
  • Name: HLA class II histocompatibility antigen, DP alpha 1 chain (DP(W3)) (DP(W4)) (HLA SB alpha chain) (MHC class II DP3 alpha) (MHC class II DPA1)
  • Length: 260  
  • Mass: 29381
• Sequence:

  MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWH
  LEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNV
  TWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVL
  CALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL

• Structural information:
  • Protein Domains: (118..21-)
    (/note="Ig-like-C1-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003006  IPR003597   IPR011162  IPR014745  IPR001003  
  • Prosite: PS50835 PS00290
  • PDB: 3LQZ 4P4K 4P4R 4P57 4P5K 4P5M
  • PDBsum: 3LQZ 4P4K 4P4R 4P57 4P5K 4P5M
  • STRING: ENSP00000393566
• Other Databases: GeneCards:  HLA-DPA1  Malacards:  HLA-DPA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019882	antigen processing and presentation	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042613	MHC class II protein complex	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0002504	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0042613	MHC class II protein complex	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0030658	transport vesicle membrane	TAS	cellular component
GO:0030658	transport vesicle membrane	TAS	cellular component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular component
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component
GO:0071556	integral component of lumenal side of endoplasmic reticulum membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0042605	peptide antigen binding	IDA	molecular function
GO:0042613	MHC class II protein complex	IDA	cellular component
GO:0071346	cellular response to interferon-gamma	IDA	biological process
GO:0050870	positive regulation of T cell activation	IMP	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	IMP	biological process
GO:0042102	positive regulation of T cell proliferation	IMP	biological process
GO:0032729	positive regulation of interferon-gamma production	IMP	biological process
GO:0009986	cell surface	IMP	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0032395	MHC class II receptor activity	NAS	molecular function
GO:0006955	immune response	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa05166	Human T-cell leukemia virus 1 infection
hsa05169	Epstein-Barr virus infection
hsa05152	Tuberculosis
hsa04145	Phagosome
hsa05164	Influenza A
hsa04514	Cell adhesion molecules
hsa05322	Systemic lupus erythematosus
hsa04659	Th17 cell differentiation
hsa05145	Toxoplasmosis
hsa04658	Th1 and Th2 cell differentiation
hsa05150	Staphylococcus aureus infection
hsa04640	Hematopoietic cell lineage
hsa05323	Rheumatoid arthritis
hsa05140	Leishmaniasis
hsa04612	Antigen processing and presentation
hsa05321	Inflammatory bowel disease
hsa05416	Viral myocarditis
hsa04672	Intestinal immune network for IgA production
hsa05320	Autoimmune thyroid disease
hsa04940	Type I diabetes mellitus
hsa05310	Asthma
hsa05332	Graft-versus-host disease
hsa05330	Allograft rejection

Diseases

Associated diseases	References
Dilated cardiomyopathy	KEGG:H00294
Systemic sclerosis	KEGG:H01492
Dilated cardiomyopathy	KEGG:H00294
Systemic sclerosis	KEGG:H01492
Onchocerciasis	PMID:8854084
Asthma	PMID:21814517
hepatocellular carcinoma	PMID:20165882
Crohn's disease	PMID:12073072
Allergic asthma	PMID:28380482
type 1 diabetes mellitus	PMID:7576003
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R