• Gene id: 311

Gene Summary

• Gene Symbol: ANXA11   Gene   UCSC   Ensembl
• Aliases: ALS23, ANX11, CAP-50, CAP50
• Gene name: annexin A11
• Alternate names: annexin A11, 56 kDa autoantigen, annexin XI, annexin-11, calcyclin-associated annexin 50, epididymis secretory sperm binding protein,
• Gene location: 10q22.3 (80205807: 80150888)     Exons: 10     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain calcium-dependent phospholipid-binding sites. The encoded
• OMIM: 602572

Protein Summary

• Protein general information: P50995  
  • Name: Annexin A11 (56 kDa autoantigen) (Annexin XI) (Annexin 11) (Calcyclin associated annexin 50) (CAP 50)
  • Length: 505  
  • Mass: 54390
• Sequence:

  MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYP
  GAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPV
  TYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQAIID
  CLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILA
  SRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTD
  ESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTK
  DRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND

• Structural information:
  • Interpro: IPR001464  IPR018502  IPR018252  IPR037104  IPR008157  
  • Prosite: PS00223 PS51897
  • STRING: ENSP00000398610
• Other Databases: GeneCards:  ANXA11  Malacards:  ANXA11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IBA	molecular function
GO:0006909	phagocytosis	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0032506	cytokinetic process	IBA	biological process
GO:0048306	calcium-dependent protein binding	IPI	molecular function
GO:0044548	S100 protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0008429	phosphatidylethanolamine binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0051592	response to calcium ion	IDA	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0042582	azurophil granule	IDA	cellular component
GO:0042581	specific granule	IDA	cellular component
GO:0005819	spindle	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045335	phagocytic vesicle	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0005819	spindle	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0051592	response to calcium ion	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0023026	MHC class II protein complex binding	HDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0048306	calcium-dependent protein binding	IPI	molecular function
GO:0048306	calcium-dependent protein binding	IPI	molecular function
GO:0032506	cytokinetic process	IMP	biological process
GO:0005635	nuclear envelope	NAS	cellular component
GO:0006909	phagocytosis	IEP	biological process
GO:0005654	nucleoplasm	NAS	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0044548	S100 protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Amyotrophic lateral sclerosis	KEGG:H00058
Amyotrophic lateral sclerosis	KEGG:H00058
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq