• Gene id: 3099

Gene Summary

• Gene Symbol: HK2   Gene   UCSC   Ensembl
• Aliases: HKII, HXK2
• Gene name: hexokinase 2
• Alternate names: hexokinase-2, hexokinase type II, hexokinase-2, muscle, hexokinase-B, muscle form hexokinase,
• Gene location: 2p12 (74834125: 74893358)     Exons: 19     NC_000002.12
• Gene summary(Entrez): Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expres
• OMIM: 601125

Protein Summary

• Protein general information: P52789  
  • Name: Hexokinase 2 (EC 2.7.1.1) (Hexokinase type II) (HK II) (Hexokinase B) (Muscle form hexokinase)
  • Length: 917  
  • Mass: 102380
  • Tissue specificity: Predominant hexokinase isozyme expressed in insulin-responsive tissues such as skeletal muscle. {ECO
• Sequence:

  MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGT
  EHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKDKKLPL
  GFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCE
  IGLIVGTGSNACYMEEMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGM
  YMGELVRLILVKMAKEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLGLDPTQEDCVATHRIC
  QIVSTRSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLRSEDGSG
  KGAAMVTAVAYRLADQHRARQKTLEHLQLSHDQLLEVKRRMKVEMERGLSKETHASAPVKMLPTYVCATPDGTEK
  GDFLALDLGGTNFRVLLVRVRNGKWGGVEMHNKIYAIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGF
  TFSFPCQQNSLDESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGFEDPHCEVG
  LIVGTGSNACYMEEMRNVELVEGEEGRMCVNMEWGAFGDNGCLDDFRTEFDVAVDELSLNPGKQRFEKMISGMYL
  GEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLALLQVRAILQHLGLESTCDDSIIVKEVCTV
  VARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKG
  AALITAVACRIREAGQR

• Structural information:
  • Protein Domains: (16..45-)
    (/note="Hexokinase-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01084-)
    (464..90-)
    (/note="Hexokinase-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01084"-)
  • Interpro: IPR001312  IPR019807  IPR022673  IPR022672  
  • Prosite: PS00378 PS51748
  • PDB: 2NZT 5HEX 5HFU 5HG1
  • PDBsum: 2NZT 5HEX 5HFU 5HG1
  • DIP: 50110
  • STRING: ENSP00000290573
• Other Databases: GeneCards:  HK2  Malacards:  HK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904925	positive regulation of autophagy of mitochondrion in response to mitochondrial depolarization	IMP	biological process
GO:0006096	glycolytic process	TAS	biological process
GO:0072656	maintenance of protein location in mitochondrion	IMP	biological process
GO:0072655	establishment of protein localization to mitochondrion	IMP	biological process
GO:0019158	mannokinase activity	IBA	molecular function
GO:0008865	fructokinase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0004340	glucokinase activity	IBA	molecular function
GO:0051156	glucose 6-phosphate metabolic process	IBA	biological process
GO:0006096	glycolytic process	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0001678	cellular glucose homeostasis	IBA	biological process
GO:0004340	glucokinase activity	IDA	molecular function
GO:0004396	hexokinase activity	IDA	molecular function
GO:0051156	glucose 6-phosphate metabolic process	IDA	biological process
GO:0008865	fructokinase activity	ISS	molecular function
GO:0006002	fructose 6-phosphate metabolic process	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004396	hexokinase activity	IEA	molecular function
GO:0005536	glucose binding	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0001678	cellular glucose homeostasis	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0006096	glycolytic process	IEA	biological process
GO:0016773	phosphotransferase activity, alcohol group as acceptor	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0006096	glycolytic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004396	hexokinase activity	TAS	molecular function
GO:0005741	mitochondrial outer membrane	NAS	cellular component
GO:0004396	hexokinase activity	IEA	molecular function
GO:0008637	apoptotic mitochondrial changes	IDA	biological process
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0061621	canonical glycolysis	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001666	response to hypoxia	IEA	biological process
GO:0002931	response to ischemia	IEA	biological process
GO:0004340	glucokinase activity	IEA	molecular function
GO:0004396	hexokinase activity	IEA	molecular function
GO:0005536	glucose binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0007595	lactation	IEA	biological process
GO:0008865	fructokinase activity	IEA	molecular function
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0004396	hexokinase activity	IEA	molecular function
GO:0006006	glucose metabolic process	IEA	biological process
GO:0008637	apoptotic mitochondrial changes	IEA	biological process
GO:0046324	regulation of glucose import	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006002	fructose 6-phosphate metabolic process	IEA	biological process
GO:0046835	carbohydrate phosphorylation	IEA	biological process
GO:0051156	glucose 6-phosphate metabolic process	IEA	biological process
GO:0035795	negative regulation of mitochondrial membrane permeability	IEA	biological process
GO:0046835	carbohydrate phosphorylation	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:2000378	negative regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0019318	hexose metabolic process	IEA	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05131	Shigellosis
hsa04910	Insulin signaling pathway
hsa01200	Carbon metabolism
hsa04066	HIF-1 signaling pathway
hsa00010	Glycolysis / Gluconeogenesis
hsa00520	Amino sugar and nucleotide sugar metabolism
hsa04930	Type II diabetes mellitus
hsa05230	Central carbon metabolism in cancer
hsa04973	Carbohydrate digestion and absorption
hsa00051	Fructose and mannose metabolism
hsa00500	Starch and sucrose metabolism
hsa00052	Galactose metabolism
hsa00524	Neomycin, kanamycin and gentamicin biosynthesis

Diseases

Associated diseases	References
type 2 diabetes mellitus	PMID:11319725
obesity	PMID:11319725
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R