• Gene id: 30968

Gene Summary

• Gene Symbol: STOML2   Gene   UCSC   Ensembl
• Aliases: HSPC108, SLP-2
• Gene name: stomatin like 2
• Alternate names: stomatin-like protein 2, mitochondrial, EPB72-like 2, EPB72-like protein 2, paraprotein target 7, paratarg-7, stomatin (EPB72)-like 2,
• Gene location: 9p13.3 (30894715: 30833625)     Exons: 9     NC_000016.10
• OMIM: 608292

Protein Summary

• Protein general information: Q9UJZ1  
  • Name: Stomatin like protein 2, mitochondrial (SLP 2) (EPB72 like protein 2) (Paraprotein target 7) (Paratarg 7)
  • Length: 356  
  • Mass: 38534
  • Tissue specificity: Ubiquitously expressed at low levels. Expressed in lymphoid tissues (at protein level). {ECO
• Sequence:

  MLARAARGTGALLLRGSLLASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILEPGLNILIPVLDRIRY
  VQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGKLSLDKVFRER
  ESLNASIVDAINQAADCWGIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQ
  ILASEAEKAEQINQAAGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTILLPS
  NPGDVTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVKMS

• Structural information:
  • Interpro: IPR001107  IPR036013  IPR032435  IPR001972  
  • STRING: ENSP00000348886
• Other Databases: GeneCards:  STOML2  Malacards:  STOML2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901612	cardiolipin binding	IDA	molecular function
GO:0051259	protein complex oligomerization	IDA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0019897	extrinsic component of plasma membrane	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	colocalizes with
GO:0008180	COP9 signalosome	IDA	colocalizes with
GO:0001772	immunological synapse	IDA	colocalizes with
GO:0042101	T cell receptor complex	IDA	colocalizes with
GO:0005758	mitochondrial intermembrane space	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:1900210	positive regulation of cardiolipin metabolic process	IMP	biological process
GO:0090297	positive regulation of mitochondrial DNA replication	IMP	biological process
GO:0042776	mitochondrial ATP synthesis coupled proton transport	IMP	biological process
GO:0034982	mitochondrial protein processing	ISS	biological process
GO:0032623	interleukin-2 production	ISS	biological process
GO:0007005	mitochondrion organization	IMP	biological process
GO:0006874	cellular calcium ion homeostasis	IMP	biological process
GO:1990046	stress-induced mitochondrial fusion	ISS	biological process
GO:0050852	T cell receptor signaling pathway	IMP	biological process
GO:0035710	CD4-positive, alpha-beta T cell activation	ISS	biological process
GO:0010918	positive regulation of mitochondrial membrane potential	IMP	biological process
GO:0010876	lipid localization	ISS	biological process
GO:0006851	mitochondrial calcium ion transmembrane transport	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006851	mitochondrial calcium ion transmembrane transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1990046	stress-induced mitochondrial fusion	IEA	biological process
GO:0035710	CD4-positive, alpha-beta T cell activation	IEA	biological process
GO:0010876	lipid localization	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0042776	mitochondrial ATP synthesis coupled proton transport	IEA	biological process
GO:0034982	mitochondrial protein processing	IEA	biological process
GO:0032623	interleukin-2 production	IEA	biological process
GO:0019897	extrinsic component of plasma membrane	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0051020	GTPase binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881