• Gene id: 3093

Gene Summary

• Gene Symbol: UBE2K   Gene   UCSC   Ensembl
• Aliases: E2-25K, HIP2, HYPG, LIG, UBC1
• Gene name: ubiquitin conjugating enzyme E2 K
• Alternate names: ubiquitin-conjugating enzyme E2 K, E2 ubiquitin-conjugating enzyme K, E2(25K), HIP-2, huntingtin-interacting protein 2, ubiquitin carrier protein, ubiquitin conjugating enzyme E2K, ubiquitin-conjugating enzyme E2(25K), ubiquitin-conjugating enzyme E2-25 KDA, ubiqu,
• Gene location: 4p14 (39698135: 39782791)     Exons: 7     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington's disease. Known functions for this protein include
• OMIM: 602846

Protein Summary

• Protein general information: P61086  
  • Name: Ubiquitin conjugating enzyme E2 K (EC 2.3.2.23) (E2 ubiquitin conjugating enzyme K) (Huntingtin interacting protein 2) (HIP 2) (Ubiquitin carrier protein) (Ubiquitin conjugating enzyme E2 25 kDa) (Ubiquitin conjugating enzyme E2(25K)) (Ubiquitin conjugati
  • Length: 200  
  • Mass: 22407
  • Tissue specificity: Expressed in all tissues tested, including spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocytes, T-lymphocytes, monocytes, granulocytes and bone marrow mononuclear cells. Highly expressed in brai
• Sequence:

  MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRF
  ITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAH
  VYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATELLLSN

• Structural information:
  • Protein Domains: (160..20-)
    (/note="UBA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00212"-)
  • Interpro: IPR015940  IPR009060  IPR042599  IPR000608  IPR023313   IPR016135  
  • Prosite: PS50030 PS00183 PS50127
  • CDD: cd14390 cd00195
  • PDB: 1YLA 2O25 3E46 3F92 3K9O 3K9P 5DFL 6IF1 6JB6 6JB7
  • PDBsum: 1YLA 2O25 3E46 3F92 3K9O 3K9P 5DFL 6IF1 6JB6 6JB7
  • DIP: 32524
  • STRING: ENSP00000261427
• Other Databases: GeneCards:  UBE2K  Malacards:  UBE2K

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061631	ubiquitin conjugating enzyme activity	IBA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0034450	ubiquitin-ubiquitin ligase activity	IDA	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:1903265	positive regulation of tumor necrosis factor-mediated signaling pathway	IMP	biological process
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA	biological process
GO:0032433	filopodium tip	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0032434	regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0070936	protein K48-linked ubiquitination	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IDA	biological process
GO:0010994	free ubiquitin chain polymerization	IDA	biological process
GO:0035458	cellular response to interferon-beta	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0060340	positive regulation of type I interferon-mediated signaling pathway	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray