• Gene id: 30851

Gene Summary

• Gene Symbol: TAX1BP3   Gene   UCSC   Ensembl
• Aliases: TIP-1, TIP1
• Gene name: Tax1 binding protein 3
• Alternate names: tax1-binding protein 3, Tax interaction protein 1, Tax1 (human T-cell leukemia virus type I) binding protein 3, glutaminase-interacting protein 3, tax-interacting protein 1,
• Gene location: 17p13.2 (3668678: 3662892)     Exons: 4     NC_000017.11
• Gene summary(Entrez): This gene encodes a small, highly conserved protein with a single PDZ domain. PDZ (PSD-95/Discs large/ZO-1 homologous) domains promote protein-protein interactions that affect cell signaling, adhesion, protein scaffolding, and receptor and ion transporter
• OMIM: 610388

Protein Summary

• Protein general information: O14907  
  • Name: Tax1 binding protein 3 (Glutaminase interacting protein 3) (Tax interaction protein 1) (TIP 1) (Tax interacting protein 1)
  • Length: 124  
  • Mass: 13735
  • Tissue specificity: Ubiquitous. Detected in brain, heart, kidney, lung, small intestine and skeletal muscle. Detected in various cell lines including HeLa. Weakly expressed in peripheral blood leukocytes. {ECO
• Sequence:

  MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGD
  KIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS

• Structural information:
  • Protein Domains: (15..11-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143"-)
  • Interpro: IPR001478  IPR036034  IPR017268  
  • Prosite: PS50106
  • PDB: 2KG2 2L4S 2L4T 2VZ5 3GJ9 3SFJ 4E3B 4NNL 4NNM
  • PDBsum: 2KG2 2L4S 2L4T 2VZ5 3GJ9 3SFJ 4E3B 4NNL 4NNM
  • STRING: ENSP00000225525
• Other Databases: GeneCards:  TAX1BP3  Malacards:  TAX1BP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090630	activation of GTPase activity	IBA	biological process
GO:0007266	Rho protein signal transduction	IBA	biological process
GO:2000009	negative regulation of protein localization to cell surface	IBA	biological process
GO:2000009	negative regulation of protein localization to cell surface	IDA	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008013	beta-catenin binding	IEA	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090630	activation of GTPase activity	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0007266	Rho protein signal transduction	IDA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	ISS	biological process
GO:0005737	cytoplasm	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq