• Gene id: 30848

Gene Summary

• Gene Symbol: CTAG2   Gene   UCSC   Ensembl
• Aliases: CAMEL, CT2, CT6.2, CT6.2a, CT6.2b, ESO2, LAGE-1, LAGE2B
• Gene name: cancer/testis antigen 2
• Alternate names: cancer/testis antigen 2, CTL-recognized antigen on melanoma, LAGE-1a protein, autoimmunogenic cancer/testis antigen NY-ESO-2, cancer/testis antigen 6.2, cancer/testis antigen family 6, member 2a, cancer/testis antigen family 6, member 2b, l antigen family member,
• Gene location: Xq28 (154653578: 154651971)     Exons: 3     NC_000023.11
• Gene summary(Entrez): This gene encodes an autoimmunogenic tumor antigen that belongs to the ESO/LAGE family of cancer-testis antigens. This protein is expressed in a wide array of cancers including melanoma, breast cancer, bladder cancer and prostate cancer. This protein is a

Protein Summary

• Protein general information: O75638  
  • Name: Cancer/testis antigen 2 (CT2) (Autoimmunogenic cancer/testis antigen NY ESO 2) (Cancer/testis antigen 6.2) (CT6.2) (L antigen family member 1) (LAGE 1)
  • Length: 210  
  • Mass: 21090
  • Tissue specificity: Testis and very low level in placenta and in some uterus samples. Observed in 25-50% of tumor samples of melanomas, non-small-cell lung carcinomas, bladder, prostate and head and neck cancers.
• Sequence:

  MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGR
  CPCGARRPDSRLLELHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRV
  VGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI

• Structural information:
  • Interpro: IPR015419  
  • STRING: ENSP00000247306
• Other Databases: GeneCards:  CTAG2  Malacards:  CTAG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070525	tRNA threonylcarbamoyladenosine metabolic process	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881