• Gene id: 30837

Gene Summary

• Gene Symbol: SOCS7   Gene   UCSC   Ensembl
• Aliases: NAP4, NCKAP4
• Gene name: suppressor of cytokine signaling 7
• Alternate names: suppressor of cytokine signaling 7, NAP-4, NCK-associated protein 4, Nck, Ash and phospholipase C binding protein, SOCS-7, nck, Ash and phospholipase C gamma-binding protein,
• Gene location: 17q12 (38351843: 38405592)     Exons: 11     NC_000017.11
• OMIM: 608788

Protein Summary

• Protein general information: O14512  
  • Name: Suppressor of cytokine signaling 7 (SOCS 7) (Nck, Ash and phospholipase C gamma binding protein) (Nck associated protein 4) (NAP 4)
  • Length: 581  
  • Mass: 62969
  • Tissue specificity: Expressed in brain and leukocytes. Also in fetal lung fibroblasts and fetal brain. {ECO
• Sequence:

  MVFRNVGRPPEEEDVEAAPEPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKT
  VGGGCCPCPCPPQPPPPQPQPPAAAPQAGEDPTETSDALLVLEGLESEAESLETNSCSEEELSSPGRGGGGGGRL
  LLQPPGPELPPVPFPLQDLVPLGRLSRGEQQQQQQQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNG
  GSGGGDGTGKRPSGELAASAASLTDMGGSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGL
  TSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIAPIRAAESLHSQPPQH
  LQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRME
  HYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFR
  IRQLVRIDHIPDLPLPKPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVEPST

• Structural information:
  • Protein Domains: (400..50-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (504..55-)
    (/note="SOCS-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00194"-)
  • Interpro: IPR000980  IPR036860  IPR028423  IPR035866  IPR037346   IPR001496  IPR036036  
  • Prosite: PS50001 PS50225
  • CDD: cd10388 cd03741
  • STRING: ENSP00000482229
• Other Databases: GeneCards:  SOCS7  Malacards:  SOCS7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046854	phosphatidylinositol phosphorylation	IBA	biological process
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	IBA	molecular function
GO:0005942	phosphatidylinositol 3-kinase complex	IBA	cellular component
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0017124	SH3 domain binding	NAS	molecular function
GO:0008150	biological_process	ND	biological process

KEGG pathways

Pathway id	Pathway name
hsa04630	JAK-STAT signaling pathway
hsa04917	Prolactin signaling pathway

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R