• Gene id: 30835

Gene Summary

• Gene Symbol: CD209   Gene   UCSC   Ensembl
• Aliases: CDSIGN, CLEC4L, DC-SIGN, DC-SIGN1
• Gene name: CD209 molecule
• Alternate names: CD209 antigen, C-type lectin domain family 4 member L, HIV gpl20-binding protein, dendritic cell-specific ICAM-3-grabbing non-integrin 1, dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin, dendritic cell-specific intracellular adh,
• Gene location: 19p13.2 (7747608: 7739992)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene encodes a C-type lectin that functions in cell adhesion and pathogen recognition. This receptor recognizes a wide range of evolutionarily divergent pathogens with a large impact on public health, including leprosy and tuberculosis mycobacteria,
• OMIM: 604672

Protein Summary

• Protein general information: Q9NNX6  
  • Name: CD209 antigen (C type lectin domain family 4 member L) (Dendritic cell specific ICAM 3 grabbing non integrin 1) (DC SIGN) (DC SIGN1) (CD antigen CD209)
  • Length: 404  
  • Mass: 45775
  • Tissue specificity: Predominantly expressed in dendritic cells and in DC-residing tissues. Also found in placental macrophages, endothelial cells of placental vascular channels, peripheral blood mononuclear cells, and THP-1 monocytes. {ECO
• Sequence:

  MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQD
  AIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQEL
  TWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAA
  VGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQ
  NFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFW
  ICKKSAASCSRDEEQFLSPAPATPNPPPA

• Structural information:
  • Protein Domains: (263..37-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR033989  IPR016187  
  • Prosite: PS00615 PS50041
  • CDD: cd03590
  • PDB: 1K9I 1SL4 1SL5 2B6B 2IT5 2IT6 2XR5 2XR6 6GHV
  • PDBsum: 1K9I 1SL4 1SL5 2B6B 2IT5 2IT6 2XR5 2XR6 6GHV
  • DIP: 60629
  • STRING: ENSP00000315477
• Other Databases: GeneCards:  CD209  Malacards:  CD209

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001618	virus receptor activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0005537	mannose binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0042129	regulation of T cell proliferation	IDA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0043657	host cell	IEA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0097323	B cell adhesion	IDA	biological process
GO:0046790	virion binding	TAS	molecular function
GO:0030246	carbohydrate binding	NAS	molecular function
GO:0019079	viral genome replication	NAS	biological process
GO:0019048	modulation by virus of host process	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005737	cytoplasm	NAS	cellular component
GO:0005537	mannose binding	TAS	molecular function
GO:0075733	intracellular transport of virus	TAS	biological process
GO:0046968	peptide antigen transport	NAS	biological process
GO:0042605	peptide antigen binding	NAS	molecular function
GO:0019062	virion attachment to host cell	TAS	biological process
GO:0009988	cell-cell recognition	TAS	biological process
GO:0007159	leukocyte cell-cell adhesion	NAS	biological process
GO:0009986	cell surface	HDA	cellular component
GO:0035556	intracellular signal transduction	NAS	biological process
GO:0019882	antigen processing and presentation	NAS	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05152	Tuberculosis
hsa04145	Phagosome
hsa05162	Measles
hsa04625	C-type lectin receptor signaling pathway

Diseases

Associated diseases	References
Asthma	PMID:21471959
Pulmonary hypertension	PMID:17107989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)