• Gene id: 30834

Gene Summary

• Gene Symbol: POLR1H   Gene   UCSC   Ensembl
• Aliases: A12.2, HTEX-6, HTEX6, Rpa12, TCTEX6, TEX6, ZNRD1, ZR14, hZR14, tctex-6
• Gene name: RNA polymerase I subunit H
• Alternate names: DNA-directed RNA polymerase I subunit RPA12, RNA polymerase I small specific subunit Rpa12, transcription-associated zinc ribbon protein, zinc ribbon domain containing 1,
• Gene location: 6p22.1 (30061264: 30064906)     Exons: 4     NC_000006.12
• Gene summary(Entrez): This gene encodes a DNA-directed RNA polymerase I subunit. The encoded protein contains two potential zinc-binding motifs and may play a role in regulation of cell proliferation. The encoded protein may be involved in cancer and human immunodeficiency vir
• OMIM: 607525

Protein Summary

• Protein general information: Q9P1U0  
  • Name: DNA directed RNA polymerase I subunit RPA12 (Zinc ribbon domain containing protein 1)
  • Length: 126  
  • Mass: 13904
• Sequence:

  MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEG
  PECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS

• Structural information:
  • Interpro: IPR019761  IPR012164  IPR034004  IPR001222  
  • Prosite: PS01030 PS00466 PS51133
  • CDD: cd10507
  • STRING: ENSP00000331111
• Other Databases: GeneCards:  POLR1H  Malacards:  POLR1H

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006363	termination of RNA polymerase I transcription	IBA	biological process
GO:0005736	RNA polymerase I complex	IBA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006379	mRNA cleavage	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003899	DNA-directed 5'-3' RNA polymerase activity	IEA	molecular function
GO:0006139	nucleobase-containing compound metabolic process	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006361	transcription initiation from RNA polymerase I promoter	TAS	biological process
GO:0006361	transcription initiation from RNA polymerase I promoter	TAS	biological process
GO:0006362	transcription elongation from RNA polymerase I promoter	TAS	biological process
GO:0006363	termination of RNA polymerase I transcription	TAS	biological process
GO:0045815	positive regulation of gene expression, epigenetic	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03020	RNA polymerase

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881