• Gene id: 3082

Gene Summary

• Gene Symbol: HGF   Gene   UCSC   Ensembl
• Aliases: DFNB39, F-TCF, HGFB, HPTA, SF
• Gene name: hepatocyte growth factor
• Alternate names: hepatocyte growth factor, fibroblast-derived tumor cytotoxic factor, hepatocyte growth factor (hepapoietin A; scatter factor), hepatopoietin-A, lung fibroblast-derived mitogen,
• Gene location: 7q21.11 (81770437: 81699005)     Exons: 20     NC_000007.14
• Gene summary(Entrez): This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. Alternative splicing results in multiple transcript variants, at least one of which
• OMIM: 142409

Protein Summary

• Protein general information: P14210  
  • Name: Hepatocyte growth factor (Hepatopoietin A) (Scatter factor) (SF) [Cleaved into: Hepatocyte growth factor alpha chain; Hepatocyte growth factor beta chain]
  • Length: 728  
  • Mass: 83,134
• Sequence:

  MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCT
  RNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQ
  PWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDH
  TESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPL
  ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVG
  YCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGP
  WCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIK
  ESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLP
  NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGG
  PLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS

• Structural information:
  • Protein Domains: PAN. (37-123)
    Kringle (128-206)
    Kringle (211-288)
    Kringle (305-383)
  • Interpro: IPR027284  IPR024174  IPR000001  IPR013806  IPR018056   IPR038178  IPR003609  IPR009003  IPR001314  IPR001254  
  • Prosite: PS00021 PS50070 PS50948 PS50240
  • CDD: cd00190
  • PDB: 1BHT 1GMN 1GMO 1GP9 1NK1 1SHY 1SI5 2HGF 2QJ2 3HMS 3HMT 3HN4 3MKP 3SP8 4D3C 4K3J 4O3T 4O3U 5COE 5CP9 5CS1 5CS3 5CS5 5CS9 5CSQ 5CT1 5CT2 5CT3
  • PDBsum: 1BHT 1GMN 1GMO 1GP9 1NK1 1SHY 1SI5 2HGF 2QJ2 3HMS 3HMT 3HN4 3MKP 3SP8 4D3C 4K3J 4O3T 4O3U 5COE 5CP9 5CS1 5CS3 5CS5 5CS9 5CSQ 5CT1 5CT2 5CT3
  • DIP: 37535
  • STRING: ENSP00000222390
• Other Databases: GeneCards:  HGF  Malacards:  HGF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0001837	epithelial to mesenchymal transition	TAS	biological process
GO:0001889	liver development	IEA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0007067	mitotic nuclear division	NAS	biological process
GO:0008083	growth factor activity	NAS	molecular function
GO:0008284	positive regulation of cell proliferation	IBA	biological process
GO:0010507	negative regulation of autophagy	NAS	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0030212	hyaluronan metabolic process	IEA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0031100	animal organ regeneration	IEA	biological process
GO:0031643	positive regulation of myelination	IEA	biological process
GO:0032715	negative regulation of interleukin-6 production	IEA	biological process
GO:0032733	positive regulation of interleukin-10 production	IEA	biological process
GO:0033137	negative regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0035729	cellular response to hepatocyte growth factor stimulus	IDA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0045669	positive regulation of osteoblast differentiation	NAS	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	NAS	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0048012	hepatocyte growth factor receptor signaling pathway	IDA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0050918	positive chemotaxis	IEA	biological process
GO:0051450	myoblast proliferation	IEA	biological process
GO:0060326	cell chemotaxis	IDA	biological process
GO:0060665	regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling	IDA	biological process
GO:0070572	positive regulation of neuron projection regeneration	IEA	biological process
GO:0090201	negative regulation of release of cytochrome c from mitochondria	IDA	biological process
GO:1900744	regulation of p38MAPK cascade	IEA	biological process
GO:1901299	negative regulation of hydrogen peroxide-mediated programmed cell death	IDA	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA	biological process
GO:1902947	regulation of tau-protein kinase activity	IEA	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IDA	biological process
GO:0004252	serine-type endopeptidase activity	NAS	molecular function
GO:0006508	proteolysis	NAS	biological process
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0000902	cell morphogenesis	IEA	biological process
GO:0001837	epithelial to mesenchymal transition	TAS	biological process
GO:0001889	liver development	IEA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0007067	mitotic nuclear division	NAS	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	NAS	molecular function
GO:0008283	cell proliferation	IEA	biological process
GO:0008284	positive regulation of cell proliferation	IBA	biological process
GO:0010507	negative regulation of autophagy	NAS	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0030212	hyaluronan metabolic process	IEA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0031100	animal organ regeneration	IEA	biological process
GO:0031643	positive regulation of myelination	IEA	biological process
GO:0032715	negative regulation of interleukin-6 production	IEA	biological process
GO:0032733	positive regulation of interleukin-10 production	IEA	biological process
GO:0033137	negative regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0035729	cellular response to hepatocyte growth factor stimulus	IDA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0045669	positive regulation of osteoblast differentiation	NAS	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	NAS	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0048012	hepatocyte growth factor receptor signaling pathway	IEA	biological process
GO:0048012	hepatocyte growth factor receptor signaling pathway	IDA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0050918	positive chemotaxis	IEA	biological process
GO:0051450	myoblast proliferation	IEA	biological process
GO:0060326	cell chemotaxis	IDA	biological process
GO:0060665	regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling	IEA	biological process
GO:0060665	regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling	IDA	biological process
GO:0070572	positive regulation of neuron projection regeneration	IEA	biological process
GO:0090201	negative regulation of release of cytochrome c from mitochondria	IDA	biological process
GO:1900744	regulation of p38MAPK cascade	IEA	biological process
GO:1901299	negative regulation of hydrogen peroxide-mediated programmed cell death	IDA	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA	biological process
GO:1902947	regulation of tau-protein kinase activity	IEA	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IDA	biological process
GO:0004252	serine-type endopeptidase activity	NAS	molecular function
GO:0006508	proteolysis	NAS	biological process
GO:0001837	epithelial to mesenchymal transition	TAS	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0007067	mitotic nuclear division	NAS	biological process
GO:0008083	growth factor activity	NAS	molecular function
GO:0008284	positive regulation of cell proliferation	IBA	biological process
GO:0010507	negative regulation of autophagy	NAS	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0035729	cellular response to hepatocyte growth factor stimulus	IDA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0045669	positive regulation of osteoblast differentiation	NAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	NAS	biological process
GO:0048012	hepatocyte growth factor receptor signaling pathway	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0060326	cell chemotaxis	IDA	biological process
GO:0060665	regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling	IDA	biological process
GO:0090201	negative regulation of release of cytochrome c from mitochondria	IDA	biological process
GO:1901299	negative regulation of hydrogen peroxide-mediated programmed cell death	IDA	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IDA	biological process
GO:0004252	serine-type endopeptidase activity	NAS	molecular function
GO:0006508	proteolysis	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04510	Focal adhesion
hsa05200	Pathways in cancer
hsa05205	Proteoglycans in cancer
hsa05225	Hepatocellular carcinoma
hsa05226	Gastric cancer
hsa05218	Melanoma
hsa05211	Renal cell carcinoma
hsa05144	Malaria
hsa01521	EGFR tyrosine kinase inhibitor resistance

Diseases

Associated diseases	References
Cancer	GAD: 15042617
Cancer (prostate)	GAD: 15042617
Cancer (meningeal)	GAD: 20406964
Cancer (breast)	GAD: 19188684
Carotid artery diseases	GAD: 20066125
Hypertension	GAD: 15127882
Carotid artery diseases	GAD: 15064106
Hyperparathyroidism	GAD: 20424473
Myopia	GAD: 16723436
Myopia	GAD: 19060265
Myopia	GAD: 19471602
Myopia	GAD: 16723436
Diabetes	GAD: 12732844
Diabetes	GAD: 12732844
Amyotrophic lateral sclerosis (ALS)	GAD: 18608101
Amyotrophic lateral sclerosis (ALS)	GAD: 18608101
Deafness	OMIM: 142409
Pelvic endometriosis	INFBASE: 15019814
Andrological diseases	INFBASE: 9570740
Endometriosis	INFBASE: 12174163
Polycystic ovary syndrome (PCOS)	INFBASE: 23036804
Female infertility	INFBASE: 12919890
Sperm motility	MIK: 11076089
Sperm motility	MIK: 10875860
Male factor infertility	MIK: 10875860
Male factor infertility	MIK: 9570740
Azoospermia of primary testicular failure	MIK: 9570740
Oligozoospermia	MIK: 9570740
Vitiligo	GAD: 19416273
Chronic renal failure	GAD: 21085059
Cryptorchidism	MIK: 28606200
Plays a crucial role in regulating male infertility	MIK: 17609297
Varicocele	MIK: 24582535

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24582535	varicocele			52 (42 subfertile patients with left clinical varicocele, 10 normozoospermic healthy donors with proven fertility)	Male infertility
17609297	Plays a crucial role in regulating male infertility				Male infertility
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq