• Gene id: 30819

Gene Summary

• Gene Symbol: KCNIP2   Gene   UCSC   Ensembl
• Aliases: KCHIP2
• Gene name: potassium voltage-gated channel interacting protein 2
• Alternate names: Kv channel-interacting protein 2, A-type potassium channel modulatory protein 2, Kv channel interacting protein 2, cardiac voltage-gated potassium channel modulatory subunit, potassium channel-interacting protein 2,
• Gene location: 10q24.32 (101843919: 101825970)     Exons: 12     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have
• OMIM: 162815

Protein Summary

• Protein general information: Q9NS61  
  • Name: Kv channel interacting protein 2 (KChIP2) (A type potassium channel modulatory protein 2) (Cardiac voltage gated potassium channel modulatory subunit) (Potassium channel interacting protein 2)
  • Length: 270  
  • Mass: 30907
  • Tissue specificity: Expressed in brain. Colocalizes with KCND2 in excitatory neurons including cortical and hippocampal CA1 pyramidal cells. Isoform 3 is expressed in heart and in umbilical vein endothelial cells. Not expressed in fetal heart. {ECO
• Sequence:

  MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPRLLDPD
  SVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFN
  AFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAP
  REHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI

• Structural information:
  • Protein Domains: (81..13-)
    (/note="EF-hand-)
    (-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (140..17-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (176..21-)
    (/note="EF-hand-3)
    (/evidence="ECO:0000255|PROSITE-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR028846  
  • Prosite: PS00018 PS50222
  • CDD: cd00051
  • STRING: ENSP00000420040
• Other Databases: GeneCards:  KCNIP2  Malacards:  KCNIP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901379	regulation of potassium ion transmembrane transport	ISS	biological process
GO:1901379	regulation of potassium ion transmembrane transport	ISS	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0005513	detection of calcium ion	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0061337	cardiac conduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005250	A-type (transient outward) potassium channel activity	IDA	contributes to
GO:0044325	ion channel binding	IPI	molecular function
GO:0015459	potassium channel regulator activity	IDA	molecular function
GO:0005250	A-type (transient outward) potassium channel activity	IDA	contributes to
GO:0097623	potassium ion export across plasma membrane	IDA	biological process
GO:0005250	A-type (transient outward) potassium channel activity	TAS	contributes to
GO:0086008	voltage-gated potassium channel activity involved in cardiac muscle cell action potential repolarization	TAS	contributes to
GO:1903818	positive regulation of voltage-gated potassium channel activity	TAS	biological process
GO:0008076	voltage-gated potassium channel complex	IDA	cellular component
GO:1901379	regulation of potassium ion transmembrane transport	IDA	biological process
GO:0086009	membrane repolarization	IDA	biological process
GO:1903766	positive regulation of potassium ion export across plasma membrane	IDA	biological process
GO:0034705	potassium channel complex	TAS	cellular component
GO:0086013	membrane repolarization during cardiac muscle cell action potential	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045163	clustering of voltage-gated potassium channels	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0008076	voltage-gated potassium channel complex	NAS	cellular component
GO:0006936	muscle contraction	NAS	biological process
GO:0008016	regulation of heart contraction	TAS	biological process
GO:0007268	chemical synaptic transmission	NAS	biological process
GO:0006813	potassium ion transport	TAS	biological process
GO:0046923	ER retention sequence binding	NAS	molecular function
GO:0005509	calcium ion binding	TAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881