• Gene id: 30818

Gene Summary

• Gene Symbol: KCNIP3   Gene   UCSC   Ensembl
• Aliases: CSEN, DREAM, KCHIP3
• Gene name: potassium voltage-gated channel interacting protein 3
• Alternate names: calsenilin, A-type potassium channel modulatory protein 3, DRE-antagonist modulator, Kv channel interacting protein 3, calsenilin, calsenilin, presenilin-binding protein, EF hand transcription factor, kv channel-interacting protein 3, potassium channel interact,
• Gene location: 2q11.1 (95297324: 95386076)     Exons: 11     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of this family are small calcium binding proteins containing EF-hand-like domai
• OMIM: 142570

Protein Summary

• Protein general information: Q9Y2W7  
  • Name: Calsenilin (A type potassium channel modulatory protein 3) (DRE antagonist modulator) (DREAM) (Kv channel interacting protein 3) (KChIP3)
  • Length: 256  
  • Mass: 29231
  • Tissue specificity: Highly expressed in brain. Widely expressed at lower levels. Expression levels are elevated in brain cortex regions affected by Alzheimer disease. {ECO
• Sequence:

  MQPAKEVTKASDGSLLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGSDSSDSELELSTVRHQ
  PEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQFFPQGDATTYAHFLFNAFDADGNGAIHFED
  FVVGLSILLRGTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRN
  QDGVVTIEEFLEACQKDENIMSSMQLFENVI

• Structural information:
  • Protein Domains: (67..12-)
    (/note="EF-hand-)
    (-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (126..16-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (162..19-)
    (/note="EF-hand-3)
    (/evidence="ECO:0000255|PROSITE-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR028846  
  • Prosite: PS00018 PS50222
  • CDD: cd00051
  • PDB: 2E6W
  • PDBsum: 2E6W
  • STRING: ENSP00000295225
• Other Databases: GeneCards:  KCNIP3  Malacards:  KCNIP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	ISS	cellular component
GO:0072659	protein localization to plasma membrane	ISS	biological process
GO:0008076	voltage-gated potassium channel complex	ISS	cellular component
GO:0015459	potassium channel regulator activity	ISS	molecular function
GO:1901379	regulation of potassium ion transmembrane transport	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0003677	DNA binding	TAS	molecular function
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0061337	cardiac conduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0044325	ion channel binding	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0032993	protein-DNA complex	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0043679	axon terminus	IEA	cellular component
GO:0015459	potassium channel regulator activity	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray