• Gene id: 30815

Gene Summary

• Gene Symbol: ST6GALNAC6   Gene   UCSC   Ensembl
• Aliases: SIAT7-F, SIAT7F, ST6GALNACVI
• Gene name: ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
• Alternate names: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, CMP-NeuAC:(beta)-N-acetylgalactosaminide (alpha)2,6-sialyltransferase member VI, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, ST,
• Gene location: 9q34.11 (127906763: 127885320)     Exons: 10     NC_000009.12
• Gene summary(Entrez): ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]).[supplied by OMIM, Mar 2008]
• OMIM: 610135

Protein Summary

• Protein general information: Q969X2  
  • Name: Alpha N acetylgalactosaminide alpha 2,6 sialyltransferase 6 (EC 2.4.99. ) (GalNAc alpha 2,6 sialyltransferase VI) (ST6GalNAc VI) (ST6GalNAcVI) (hST6GalNAc VI) (Sialyltransferase 7F) (SIAT7 F)
  • Length: 333  
  • Mass: 38,068
• Sequence:

  MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRG
  RSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNK
  TTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDD
  LFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEH
  SRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT

• Structural information:
  • Interpro: IPR001675  IPR038578  IPR012163  
  • STRING: ENSP00000291839
• Other Databases: GeneCards:  ST6GALNAC6  Malacards:  ST6GALNAC6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	TAS	cellular component
GO:0001574	ganglioside biosynthetic process	ISS	biological process
GO:0001574	ganglioside biosynthetic process	IBA	biological process
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	ISS	molecular function
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IBA	molecular function
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	TAS	molecular function
GO:0005737	cytoplasm	ISS	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0006677	glycosylceramide metabolic process	IDA	biological process
GO:0006687	glycosphingolipid metabolic process	IDA	biological process
GO:0008373	sialyltransferase activity	ISS	molecular function
GO:0008373	sialyltransferase activity	IDA	molecular function
GO:0009100	glycoprotein metabolic process	IDA	biological process
GO:0009311	oligosaccharide metabolic process	IBA	biological process
GO:0009312	oligosaccharide biosynthetic process	ISS	biological process
GO:0009988	cell-cell recognition	IC	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0018279	protein N-linked glycosylation via asparagine	IBA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0001574	ganglioside biosynthetic process	IEA	biological process
GO:0001574	ganglioside biosynthetic process	ISS	biological process
GO:0001574	ganglioside biosynthetic process	IBA	biological process
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IEA	molecular function
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	ISS	molecular function
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IBA	molecular function
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	TAS	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0006677	glycosylceramide metabolic process	IDA	biological process
GO:0006687	glycosphingolipid metabolic process	IDA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0008373	sialyltransferase activity	ISS	molecular function
GO:0008373	sialyltransferase activity	IDA	molecular function
GO:0009100	glycoprotein metabolic process	IDA	biological process
GO:0009311	oligosaccharide metabolic process	IBA	biological process
GO:0009312	oligosaccharide biosynthetic process	IEA	biological process
GO:0009312	oligosaccharide biosynthetic process	ISS	biological process
GO:0009988	cell-cell recognition	IC	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0018279	protein N-linked glycosylation via asparagine	IBA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0001574	ganglioside biosynthetic process	ISS	biological process
GO:0001574	ganglioside biosynthetic process	IBA	biological process
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	ISS	molecular function
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IBA	molecular function
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	TAS	molecular function
GO:0005737	cytoplasm	ISS	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0006677	glycosylceramide metabolic process	IDA	biological process
GO:0006687	glycosphingolipid metabolic process	IDA	biological process
GO:0008373	sialyltransferase activity	ISS	molecular function
GO:0008373	sialyltransferase activity	IDA	molecular function
GO:0009100	glycoprotein metabolic process	IDA	biological process
GO:0009311	oligosaccharide metabolic process	IBA	biological process
GO:0009312	oligosaccharide biosynthetic process	ISS	biological process
GO:0009988	cell-cell recognition	IC	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0018279	protein N-linked glycosylation via asparagine	IBA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways

Diseases

Associated diseases	References
Male factor infertility	MIK: 7524922
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male fertility	MIK: 7524922
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
7524922	Male fertility			42 males (14 volunteers from semen donation and 28 males from infertile couples)	Male infertility	CA 125 CA 19.9
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881