• Gene id: 3071

Gene Summary

• Gene Symbol: NCKAP1L   Gene   UCSC   Ensembl
• Aliases: HEM1
• Gene name: NCK associated protein 1 like
• Alternate names: nck-associated protein 1-like, hematopoietic protein 1, membrane-associated protein hem-1,
• Gene location: 12q13.13-q13.2 (54497751: 54548242)     Exons: 32     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the HEM family of tissue-specific transmembrane proteins which are highly conserved from invertebrates through mammals. This gene is only expressed in hematopoietic cells. The encoded protein is a part of the Scar/WAVE comple

Protein Summary

• Protein general information: P55160  
  • Name: Nck associated protein 1 like (Hematopoietic protein 1) (Membrane associated protein HEM 1)
  • Length: 1127  
  • Mass: 128153
  • Tissue specificity: Expressed only in cells of hematopoietic origin (PubMed
• Sequence:

  MSLTSAYQHKLAEKLTILNDRGQGVLIRMYNIKKTCSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNSTQHLG
  PVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFDINLNFDFTRSYLDLIVTYTSVILLLSRIED
  RRILIGMYNCAHEMLHGHGDPSFARLGQMVLEYDHPLKKLTEEFGPHTKAVSGALLSLHFLFVRRNQGAEQWRSA
  QLLSLISNPPAMINPANSDTMACEYLSVEVMERWIIIGFLLCHGCLNSNSQCQKLWKLCLQGSLYITLIREDVLQ
  VHKVTEDLFSSLKGYGKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKELETVLADEPGLLGPKALFAFMALSF
  IRDEVTWLVRHTENVTKTKTPEDYADSSIAELLFLLEGIRSLVRRHIKVIQQYHLQYLARFDALVLSDIIQNLSV
  CPEEESIIMSSFVSILSSLNLKQVDNGEKFEFSGLRLDWFRLQAYTSVAKAPLHLHENPDLAKVMNLIVFHSRML
  DSVEKLLVETSDLSTFCFHLRIFEKMFAMTLEESAMLRYAIAFPLICAHFVHCTHEMCPEEYPHLKNHGLHHCNS
  FLEELAKQTSNCVLEICAEQRNLSEQLLPKHCATTISKAKNKKTRKQRQTPRKGEPERDKPGAESHRKNRSIVTN
  MDKLHLNLTELALTMNHVYSFSVFEHTIFPSEYLSSHLEARLNRAIVWLAGYNATTQEIVRPSELLAGVKAYIGF
  IQSLAQFLGADASRVIRNALLQQTQPLDSCGEQTITTLYTNWYLESLLRQASSGTIILSPAMQAFVSLPREGEQN
  FSAEEFSDISEMRALAELLGPYGMKFLSENLMWHVTSQIVELKKLVVENMDILVQIRSNFSKPDLMASLLPQLTG
  AENVLKRMTIIGVILSFRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSIFELASAAGVGCDIDPA
  LVAAIANLKADTSSPEEEYKVACLLLIFLAVSLPLLATDPSSFYSIEKDGYNNNIHCLTKAIIQVSAALFTLYNK
  NIETHLKEFLVVASVSLLQLGQETDKLKTRNRESISLLMRLVVEESSFLTLDMLESCFPYVLLRNAYREVSRAFH
  LN

• Structural information:
  • Interpro: IPR019137  
  • STRING: ENSP00000293373
• Other Databases: GeneCards:  NCKAP1L  Malacards:  NCKAP1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030866	cortical actin cytoskeleton organization	IBA	biological process
GO:0030031	cell projection assembly	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0000902	cell morphogenesis	IBA	biological process
GO:0048812	neuron projection morphogenesis	IBA	biological process
GO:0048365	Rac GTPase binding	IBA	contributes to
GO:0031209	SCAR complex	IBA	cellular component
GO:0034101	erythrocyte homeostasis	ISS	biological process
GO:0030866	cortical actin cytoskeleton organization	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0045648	positive regulation of erythrocyte differentiation	IEA	biological process
GO:0043378	positive regulation of CD8-positive, alpha-beta T cell differentiation	IEA	biological process
GO:0043029	T cell homeostasis	IEA	biological process
GO:0034101	erythrocyte homeostasis	IEA	biological process
GO:0033630	positive regulation of cell adhesion mediated by integrin	IEA	biological process
GO:0030866	cortical actin cytoskeleton organization	IEA	biological process
GO:0002262	myeloid cell homeostasis	IEA	biological process
GO:0090023	positive regulation of neutrophil chemotaxis	IEA	biological process
GO:0065003	protein-containing complex assembly	IEA	biological process
GO:0060100	positive regulation of phagocytosis, engulfment	IEA	biological process
GO:0045621	positive regulation of lymphocyte differentiation	IEA	biological process
GO:0045588	positive regulation of gamma-delta T cell differentiation	IEA	biological process
GO:0045579	positive regulation of B cell differentiation	IEA	biological process
GO:0043372	positive regulation of CD4-positive, alpha-beta T cell differentiation	IEA	biological process
GO:0042102	positive regulation of T cell proliferation	IEA	biological process
GO:0032715	negative regulation of interleukin-6 production	IEA	biological process
GO:0032700	negative regulation of interleukin-17 production	IEA	biological process
GO:0031209	SCAR complex	IEA	cellular component
GO:0030838	positive regulation of actin filament polymerization	IEA	biological process
GO:0001782	B cell homeostasis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0006935	chemotaxis	IDA	biological process
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0031209	SCAR complex	IDA	cellular component
GO:0030593	neutrophil chemotaxis	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0043378	positive regulation of CD8-positive, alpha-beta T cell differentiation	ISS	biological process
GO:0043029	T cell homeostasis	ISS	biological process
GO:0030295	protein kinase activator activity	IMP	molecular function
GO:0030011	maintenance of cell polarity	IMP	biological process
GO:0060100	positive regulation of phagocytosis, engulfment	ISS	biological process
GO:0045621	positive regulation of lymphocyte differentiation	ISS	biological process
GO:0045579	positive regulation of B cell differentiation	ISS	biological process
GO:0032715	negative regulation of interleukin-6 production	ISS	biological process
GO:0065003	protein-containing complex assembly	ISS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090023	positive regulation of neutrophil chemotaxis	ISS	biological process
GO:0070358	actin polymerization-dependent cell motility	IMP	biological process
GO:0045588	positive regulation of gamma-delta T cell differentiation	ISS	biological process
GO:0043372	positive regulation of CD4-positive, alpha-beta T cell differentiation	ISS	biological process
GO:0042493	response to drug	IMP	biological process
GO:0042327	positive regulation of phosphorylation	IMP	biological process
GO:0042102	positive regulation of T cell proliferation	ISS	biological process
GO:0035509	negative regulation of myosin-light-chain-phosphatase activity	IMP	biological process
GO:0032700	negative regulation of interleukin-17 production	ISS	biological process
GO:0030890	positive regulation of B cell proliferation	IMP	biological process
GO:0030838	positive regulation of actin filament polymerization	IMP	biological process
GO:0005096	GTPase activator activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001782	B cell homeostasis	ISS	biological process
GO:0050853	B cell receptor signaling pathway	IMP	biological process
GO:0048821	erythrocyte development	IEP	biological process
GO:0045648	positive regulation of erythrocyte differentiation	ISS	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0033630	positive regulation of cell adhesion mediated by integrin	ISS	biological process
GO:0030866	cortical actin cytoskeleton organization	IMP	biological process
GO:0002262	myeloid cell homeostasis	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04810	Regulation of actin cytoskeleton
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881