• Gene id: 307

Gene Summary

• Gene Symbol: ANXA4   Gene   UCSC   Ensembl
• Aliases: ANX4, HEL-S-274, P32.5, PAP-II, PIG28, PP4-X, ZAP36
• Gene name: annexin A4
• Alternate names: annexin A4, 35-beta calcimedin, annexin IV (placental anticoagulant protein II), annexin-4, carbohydrate-binding protein p33/p41, chromobindin-4, endonexin I, epididymis secretory protein Li 274, lipocortin IV, placental anticoagulant protein II, prolifer,
• Gene location: 2p13.3 (69643804: 69826476)     Exons: 20     NC_000002.12
• Gene summary(Entrez): Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocyto
• OMIM: 106491

SNPs

rs4919686

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000010.11   g.102832492A>C
NC_000010.10   g.104592249A>C
NG_007955.1   g.10042T>G|SEQ=[A/C]|GENE=CYP17A1
CYP17A1-AS1   102724307

Protein Summary

• Protein general information: P09525  
  • Name: Annexin A4 (35 beta calcimedin) (Annexin IV) (Annexin 4) (Carbohydrate binding protein p33/p41) (Chromobindin 4) (Endonexin I) (Lipocortin IV) (P32.5) (PP4 X) (Placental anticoagulant protein II) (PAP II) (Protein II)
  • Length: 319  
  • Mass: 35,883
• Sequence:

  MATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGN
  FEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQR
  VLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIK
  SETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIK
  GDTSGDYRKVLLVLCGGDD

• Structural information:
  • Interpro: IPR001464  IPR018502  IPR018252  IPR037104  IPR002391  
  • Prosite: PS00223
  • PDB: 2ZOC
  • PDBsum: 2ZOC
  • STRING: ENSP00000377833
• Other Databases: GeneCards:  ANXA4  Malacards:  ANXA4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004859	phospholipase inhibitor activity	NAS	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005544	calcium-dependent phospholipid binding	IDA	molecular function
GO:0005544	calcium-dependent phospholipid binding	NAS	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006357	regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0012506	vesicle membrane	IDA	cellular component
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0031965	nuclear membrane	IDA	cellular component
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0048306	calcium-dependent protein binding	IPI	molecular function
GO:0048306	calcium-dependent protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0051059	NF-kappaB binding	IPI	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:2000483	negative regulation of interleukin-8 secretion	IMP	biological process
GO:0004859	phospholipase inhibitor activity	NAS	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0005544	calcium-dependent phospholipid binding	IDA	molecular function
GO:0005544	calcium-dependent phospholipid binding	NAS	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006357	regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0012506	vesicle membrane	IDA	cellular component
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0031965	nuclear membrane	IDA	cellular component
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0048306	calcium-dependent protein binding	IPI	molecular function
GO:0048306	calcium-dependent protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0051059	NF-kappaB binding	IPI	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:2000483	negative regulation of interleukin-8 secretion	IMP	biological process
GO:0004859	phospholipase inhibitor activity	NAS	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005544	calcium-dependent phospholipid binding	IDA	molecular function
GO:0005544	calcium-dependent phospholipid binding	NAS	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006357	regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0012506	vesicle membrane	IDA	cellular component
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0031965	nuclear membrane	IDA	cellular component
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0048306	calcium-dependent protein binding	IPI	molecular function
GO:0048306	calcium-dependent protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0051059	NF-kappaB binding	IPI	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:2000483	negative regulation of interleukin-8 secretion	IMP	biological process

Diseases

Associated diseases	References
Endometriosis	INFBASE: 22883517
Male factor infertility	MIK: 20369545
Asthenozoospermia	MIK: 20369545
Female infertility	INFBASE: 22999554
Asthenozoospermia	MIK: 20231113
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20369545	Asthenozoospermia			6 seminal plasma samples were collected by Percoll respectively from healthy fertile and asthenozoospermia volunteers	Male infertility	annexin VI isoform 2 isoform 1 of interleukin-6 receptor subunit beta precursor Mr 400 000 protein cytosolic dynein heavy chain alpha-actinin-4 receptor-type tyrosine-protein phosphatase eta precursor vitamin D-binding protein precursor protein S10
20231113	Asthenozoospermia			12 (6 healthy fertile men, 6 asthenozoospermia volunteers)	Male infertility	annexin VI isoform 2 isoform 1 of interleukin-6 receptor subunit beta precursor Mr 400 000 protein cytosolic dynein heavy chain alpha-actinin-4 receptor-type tyrosine-protein phosphatase eta precursor vitamin D-binding protein precursor protein S10
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881