• Gene id: 3068

Gene Summary

• Gene Symbol: HDGF   Gene   UCSC   Ensembl
• Aliases: HMG1L2
• Gene name: heparin binding growth factor
• Alternate names: hepatoma-derived growth factor, epididymis secretory sperm binding protein, hepatoma derived growth factor, high mobility group protein 1-like 2,
• Gene location: 1q23.1 (156752447: 156742106)     Exons: 13     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growt
• OMIM: 600339

Protein Summary

• Protein general information: P51858  
  • Name: Hepatoma derived growth factor (HDGF) (High mobility group protein 1 like 2) (HMG 1L2)
  • Length: 240  
  • Mass: 26788
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKYQVFFFGTHETAFLGPKDLFPYEESKEKFGK
  PNKRKGFSEGLWEIENNPTVKASGYQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLVIDEPAKEKNE
  KGALKRRAGDLLEDSPKRPKEAENPEGEEKEAATLEVERPLPMEVEKNSTPSEPGSGRGPPQEEEEEEDEEEEAT
  KEDAEAPGIRDHESL

• Structural information:
  • Protein Domains: (12..6-)
    (/note="PWWP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00162"-)
  • Interpro: IPR035496  IPR000313  
  • Prosite: PS50812
  • CDD: cd05834
  • PDB: 1RI0 2NLU
  • PDBsum: 1RI0 2NLU
  • STRING: ENSP00000357189
• Other Databases: GeneCards:  HDGF  Malacards:  HDGF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008201	heparin binding	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0007165	signal transduction	NAS	biological process
GO:0036498	IRE1-mediated unfolded protein response	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0009987	cellular process	IEA	biological process
GO:0098761	cellular response to interleukin-7	IEA	biological process
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0001222	transcription corepressor binding	IPI	molecular function
GO:0005615	extracellular space	HDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)