• Gene id: 3066

Gene Summary

• Gene Symbol: HDAC2   Gene   UCSC   Ensembl
• Aliases: HD2, KDAC2, RPD3, YAF1
• Gene name: histone deacetylase 2
• Alternate names: histone deacetylase 2, YY1-associated factor 1, transcriptional regulator homolog RPD3,
• Gene location: 6q21 (113971147: 113933027)     Exons: 17     NC_000006.12
• Gene summary(Entrez): This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3
• OMIM: 605164

Protein Summary

• Protein general information: Q92769  
  • Name: Histone deacetylase 2 (HD2) (EC 3.5.1.98)
  • Length: 488  
  • Mass: 55364
  • Tissue specificity: Widely expressed; lower levels in brain and lung.
• Sequence:

  MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK
  FLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASG
  FCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAV
  NFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
  GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLP
  HAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEED
  KKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP

• Structural information:
  • Interpro: IPR000286  IPR003084  IPR023801  IPR037138  IPR023696  
  • PDB: 3MAX 4LXZ 4LY1 5IWG 5IX0 6G3O
  • PDBsum: 3MAX 4LXZ 4LY1 5IWG 5IX0 6G3O
  • DIP: 24220
  • STRING: ENSP00000430432
• Other Databases: GeneCards:  HDAC2  Malacards:  HDAC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070822	Sin3-type complex	IBA	cellular component
GO:0004407	histone deacetylase activity	IBA	molecular function
GO:0000118	histone deacetylase complex	IBA	cellular component
GO:0070933	histone H4 deacetylation	IBA	biological process
GO:0070932	histone H3 deacetylation	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0035098	ESC/E(Z) complex	IDA	cellular component
GO:0016581	NuRD complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0016358	dendrite development	ISS	biological process
GO:0003682	chromatin binding	ISS	molecular function
GO:0051059	NF-kappaB binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070933	histone H4 deacetylation	ISS	biological process
GO:0070932	histone H3 deacetylation	ISS	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0019213	deacetylase activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0016575	histone deacetylation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0032041	NAD-dependent histone deacetylase activity (H3-K14 specific)	IEA	molecular function
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001975	response to amphetamine	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0032732	positive regulation of interleukin-1 production	IEA	biological process
GO:0034605	cellular response to heat	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0061000	negative regulation of dendritic spine development	IEA	biological process
GO:0071560	cellular response to transforming growth factor beta stimulus	IEA	biological process
GO:1902437	positive regulation of male mating behavior	IEA	biological process
GO:1990841	promoter-specific chromatin binding	IEA	molecular function
GO:0000785	chromatin	IEA	cellular component
GO:0003300	cardiac muscle hypertrophy	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008134	transcription factor binding	IEA	molecular function
GO:0010718	positive regulation of epithelial to mesenchymal transition	IEA	biological process
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0019213	deacetylase activity	IEA	molecular function
GO:0019899	enzyme binding	IEA	molecular function
GO:0031000	response to caffeine	IEA	biological process
GO:0031072	heat shock protein binding	IEA	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IEA	biological process
GO:0035094	response to nicotine	IEA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IEA	biological process
GO:0043392	negative regulation of DNA binding	IEA	biological process
GO:0048149	behavioral response to ethanol	IEA	biological process
GO:0048714	positive regulation of oligodendrocyte differentiation	IEA	biological process
GO:0055093	response to hyperoxia	IEA	biological process
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0070932	histone H3 deacetylation	IEA	biological process
GO:0071300	cellular response to retinoic acid	IEA	biological process
GO:1903351	cellular response to dopamine	IEA	biological process
GO:2000757	negative regulation of peptidyl-lysine acetylation	IEA	biological process
GO:0004407	histone deacetylase activity	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0001103	RNA polymerase II repressing transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0033558	protein deacetylase activity	IMP	molecular function
GO:0016580	Sin3 complex	IDA	cellular component
GO:0016581	NuRD complex	IDA	cellular component
GO:0045347	negative regulation of MHC class II biosynthetic process	IC	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IC	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IC	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0006338	chromatin remodeling	IC	biological process
GO:0032967	positive regulation of collagen biosynthetic process	IC	biological process
GO:0070829	heterochromatin maintenance	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0009913	epidermal cell differentiation	ISS	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0045862	positive regulation of proteolysis	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0061029	eyelid development in camera-type eye	ISS	biological process
GO:0061198	fungiform papilla formation	ISS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0010870	positive regulation of receptor biosynthetic process	IMP	biological process
GO:0010977	negative regulation of neuron projection development	ISS	biological process
GO:0016575	histone deacetylation	IMP	biological process
GO:0042475	odontogenesis of dentin-containing tooth	ISS	biological process
GO:0042733	embryonic digit morphogenesis	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0060789	hair follicle placode formation	ISS	biological process
GO:0016581	NuRD complex	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016580	Sin3 complex	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0043044	ATP-dependent chromatin remodeling	HDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	HDA	cellular component
GO:0031492	nucleosomal DNA binding	HDA	contributes to
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	HDA	contributes to
GO:0000790	nuclear chromatin	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05016	Huntington disease
hsa05165	Human papillomavirus infection
hsa05206	MicroRNAs in cancer
hsa05034	Alcoholism
hsa05203	Viral carcinogenesis
hsa05169	Epstein-Barr virus infection
hsa05202	Transcriptional misregulation in cancer
hsa04110	Cell cycle
hsa04919	Thyroid hormone signaling pathway
hsa05220	Chronic myeloid leukemia
hsa05031	Amphetamine addiction
hsa04330	Notch signaling pathway
hsa04213	Longevity regulating pathway - multiple species

Diseases

Associated diseases	References
Prostate cancer	PMID:18212746
Stomach cancer	PMID:15865607
Stomach cancer	PMID:23175521
Asthma	PMID:20538962
Temporal lobe epilepsy	PMID:21987499
Pulmonary hypertension	PMID:22711276
hepatocellular carcinoma	PMID:24448241
cervix uteri carcinoma in situ	PMID:19147762
type 1 diabetes mellitus	PMID:22772764
Alopecia areata	PMID:21936853
acute lymphocytic leukemia	PMID:23948281
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881