• Gene id: 3060

Gene Summary

• Gene Symbol: HCRT   Gene   UCSC   Ensembl
• Aliases: NRCLP1, OX, PPOX
• Gene name: hypocretin neuropeptide precursor
• Alternate names: orexin, hypocretin (orexin) neuropeptide, prepro-orexin,
• Gene location: 17q21.2 (42185451: 42184059)     Exons: 2     NC_000017.11
• Gene summary(Entrez): This gene encodes a hypothalamic neuropeptide precursor protein that gives rise to two mature neuropeptides, orexin A and orexin B, by proteolytic processing. Orexin A and orexin B, which bind to orphan G-protein coupled receptors HCRTR1 and HCRTR2, funct
• OMIM: 605240

Protein Summary

• Protein general information: O43612  
  • Name: Orexin (Hypocretin) (Hcrt) [Cleaved into: Orexin A (Hypocretin 1) (Hcrt1); Orexin B (Hypocretin 2) (Hcrt2)]
  • Length: 131  
  • Mass: 13363
  • Tissue specificity: Abundantly expressed in subthalamic nucleus but undetectable in other brain regions tested (hypothalamus was not tested) and in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas.
• Sequence:

  MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRSGPPG
  LQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCLGRRCSAPAAASVAPGGQSGI

• Structural information:
  • Interpro: IPR001704  
  • PDB: 1CQ0 1R02 1UVQ 1WSO
  • PDBsum: 1CQ0 1R02 1UVQ 1WSO
  • STRING: ENSP00000293330
• Other Databases: GeneCards:  HCRT  Malacards:  HCRT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048471	perinuclear region of cytoplasm	IBA	cellular component
GO:0046928	regulation of neurotransmitter secretion	IBA	biological process
GO:0042755	eating behavior	IBA	biological process
GO:0042594	response to starvation	IBA	biological process
GO:0005184	neuropeptide hormone activity	IBA	molecular function
GO:0051971	positive regulation of transmission of nerve impulse	IBA	biological process
GO:0031772	type 2 hypocretin receptor binding	IBA	molecular function
GO:0031771	type 1 hypocretin receptor binding	IBA	molecular function
GO:0030431	sleep	IBA	biological process
GO:0001659	temperature homeostasis	IBA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007631	feeding behavior	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0008021	synaptic vesicle	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005184	neuropeptide hormone activity	IEA	molecular function
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007205	protein kinase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0008156	negative regulation of DNA replication	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0042755	eating behavior	IEA	biological process
GO:0046928	regulation of neurotransmitter secretion	IEA	biological process
GO:0051928	positive regulation of calcium ion transport	IEA	biological process
GO:0051970	negative regulation of transmission of nerve impulse	IEA	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0001659	temperature homeostasis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0031771	type 1 hypocretin receptor binding	IEA	molecular function
GO:0031772	type 2 hypocretin receptor binding	IEA	molecular function
GO:0043267	negative regulation of potassium ion transport	IEA	biological process
GO:0051971	positive regulation of transmission of nerve impulse	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0098794	postsynapse	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Narcolepsy	KEGG:H01293
Narcolepsy	KEGG:H01293
Sleep apnea	PMID:15627867
Prader-Willi syndrome	PMID:15613151
Guillain-Barre syndrome	PMID:15623725
obesity	PMID:16135994
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881