• Gene id: 306

Gene Summary

• Gene Symbol: ANXA3   Gene   UCSC   Ensembl
• Aliases: ANX3
• Gene name: annexin A3
• Alternate names: annexin A3, 35-alpha calcimedin, Annexin III (lipocortin III), PAP-III, annexin III (lipocortin III, 1,2-cyclic-inositol-phosphate phosphodiesterase, placental anticoagulant protein III, calcimedin 35-alpha), annexin-3, calcimedin 35-alpha, inositol 1,2-cyclic p,
• Gene location: 4q21.21 (8182071: 8241102)     Exons: 22     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of pho
• OMIM: 106490

Protein Summary

• Protein general information: P12429  
  • Name: Annexin A3 (35 alpha calcimedin) (Annexin III) (Annexin 3) (Inositol 1,2 cyclic phosphate 2 phosphohydrolase) (Lipocortin III) (Placental anticoagulant protein III) (PAP III)
  • Length: 323  
  • Mass: 36375
• Sequence:

  MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKDDLKGD
  LSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSLGDDISSETSG
  DFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIV
  DSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLY
  SAIKSDTSGDYEITLLKICGGDD

• Structural information:
  • Interpro: IPR001464  IPR018502  IPR018252  IPR037104  IPR002390  
  • Prosite: PS00223 PS51897
  • PDB: 1AII 1AXN
  • PDBsum: 1AII 1AXN
  • STRING: ENSP00000264908
• Other Databases: GeneCards:  ANXA3  Malacards:  ANXA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0004859	phospholipase inhibitor activity	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0019834	phospholipase A2 inhibitor activity	IEA	molecular function
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051054	positive regulation of DNA metabolic process	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0021766	hippocampus development	IEA	biological process
GO:0019834	phospholipase A2 inhibitor activity	IEA	molecular function
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0070848	response to growth factor	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0031100	animal organ regeneration	IEA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0048306	calcium-dependent protein binding	IPI	molecular function
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0010595	positive regulation of endothelial cell migration	IDA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0042742	defense response to bacterium	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006909	phagocytosis	IDA	biological process
GO:0005544	calcium-dependent phospholipid binding	IDA	molecular function
GO:0005544	calcium-dependent phospholipid binding	IDA	molecular function
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0043312	neutrophil degranulation	IDA	biological process
GO:0042581	specific granule	IDA	cellular component
GO:0030670	phagocytic vesicle membrane	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)