• Gene id: 3059

Gene Summary

• Gene Symbol: HCLS1   Gene   UCSC   Ensembl
• Aliases: CTTNL, HS1, lckBP1, p75
• Gene name: hematopoietic cell-specific Lyn substrate 1
• Alternate names: hematopoietic lineage cell-specific protein,
• Gene location: 3q13.33 (121660902: 121631398)     Exons: 14     NC_000003.12
• OMIM: 605166

Protein Summary

• Protein general information: P14317  
  • Name: Hematopoietic lineage cell specific protein (Hematopoietic cell specific LYN substrate 1) (LckBP1) (p75)
  • Length: 486  
  • Mass: 54014
  • Tissue specificity: Expressed only in tissues and cells of hematopoietic origin.
• Sequence:

  MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMES
  GPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAVGFDYKGEVEKHTSQ
  KDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKT
  TPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISS
  EAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPE
  NDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAGAGAGAVALGISAVAVYDYQGEGSDELSFD
  PDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE

• Structural information:
  • Protein Domains: (428..48-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR028534  IPR003134  IPR036028  IPR001452  
  • Prosite: PS51090 PS50002
  • STRING: ENSP00000320176
• Other Databases: GeneCards:  HCLS1  Malacards:  HCLS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030425	dendrite	IBA	cellular component
GO:0045773	positive regulation of axon extension	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0061003	positive regulation of dendritic spine morphogenesis	IBA	biological process
GO:0098974	postsynaptic actin cytoskeleton organization	IBA	biological process
GO:0005884	actin filament	IBA	colocalizes with
GO:0005886	plasma membrane	IBA	cellular component
GO:0014069	postsynaptic density	IBA	cellular component
GO:0030027	lamellipodium	IBA	cellular component
GO:0030427	site of polarized growth	IBA	cellular component
GO:0030833	regulation of actin filament polymerization	IBA	biological process
GO:0030864	cortical actin cytoskeleton	IBA	cellular component
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0048812	neuron projection morphogenesis	IBA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0030041	actin filament polymerization	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	TAS	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045651	positive regulation of macrophage differentiation	IEA	biological process
GO:0030218	erythrocyte differentiation	IEA	biological process
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IEA	biological process
GO:0030854	positive regulation of granulocyte differentiation	IEA	biological process
GO:0009725	response to hormone	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IMP	biological process
GO:2000107	negative regulation of leukocyte apoptotic process	IMP	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005667	transcription regulator complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:2000251	positive regulation of actin cytoskeleton reorganization	IC	biological process
GO:0042307	positive regulation of protein import into nucleus	IMP	biological process
GO:0030833	regulation of actin filament polymerization	IMP	biological process
GO:0030854	positive regulation of granulocyte differentiation	IMP	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IMP	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0051897	positive regulation of protein kinase B signaling	IMP	biological process
GO:0071345	cellular response to cytokine stimulus	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0030218	erythrocyte differentiation	ISS	biological process
GO:0008284	positive regulation of cell population proliferation	ISS	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0009725	response to hormone	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0030425	dendrite	IBA	cellular component
GO:0045773	positive regulation of axon extension	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0061003	positive regulation of dendritic spine morphogenesis	IBA	biological process
GO:0098974	postsynaptic actin cytoskeleton organization	IBA	biological process
GO:0005884	actin filament	IBA	colocalizes with
GO:0005886	plasma membrane	IBA	cellular component
GO:0014069	postsynaptic density	IBA	cellular component
GO:0030027	lamellipodium	IBA	cellular component
GO:0030427	site of polarized growth	IBA	cellular component
GO:0030833	regulation of actin filament polymerization	IBA	biological process
GO:0030864	cortical actin cytoskeleton	IBA	cellular component
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0048812	neuron projection morphogenesis	IBA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0030041	actin filament polymerization	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	TAS	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045651	positive regulation of macrophage differentiation	IEA	biological process
GO:0030218	erythrocyte differentiation	IEA	biological process
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IEA	biological process
GO:0030854	positive regulation of granulocyte differentiation	IEA	biological process
GO:0009725	response to hormone	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IMP	biological process
GO:2000107	negative regulation of leukocyte apoptotic process	IMP	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005667	transcription regulator complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:2000251	positive regulation of actin cytoskeleton reorganization	IC	biological process
GO:0042307	positive regulation of protein import into nucleus	IMP	biological process
GO:0030833	regulation of actin filament polymerization	IMP	biological process
GO:0030854	positive regulation of granulocyte differentiation	IMP	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IMP	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0051897	positive regulation of protein kinase B signaling	IMP	biological process
GO:0071345	cellular response to cytokine stimulus	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0030218	erythrocyte differentiation	ISS	biological process
GO:0008284	positive regulation of cell population proliferation	ISS	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0009725	response to hormone	ISS	biological process
GO:0005634	nucleus	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa05130	Pathogenic Escherichia coli infection
hsa05205	Proteoglycans in cancer
hsa04530	Tight junction
hsa05100	Bacterial invasion of epithelial cells

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881