• Gene id: 3055

Gene Summary

• Gene Symbol: HCK   Gene   UCSC   Ensembl
• Aliases: JTK9, p59Hck, p61Hck
• Gene name: HCK proto-oncogene, Src family tyrosine kinase
• Alternate names: tyrosine-protein kinase HCK, hematopoietic cell kinase, hemopoietic cell kinase, p59-HCK/p60-HCK,
• Gene location: 20q11.21 (32052241: 32101842)     Exons: 15     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the Src family of tyrosine kinases. This protein is primarily hemopoietic, particularly in cells of the myeloid and B-lymphoid lineages. It may help couple the Fc receptor to the activation of the respirator
• OMIM: 610654

Protein Summary

• Protein general information: P08631  
  • Name: Tyrosine protein kinase HCK (EC 2.7.10.2) (Hematopoietic cell kinase) (Hemopoietic cell kinase) (p59 HCK/p60 HCK) (p59Hck) (p61Hck)
  • Length: 526  
  • Mass: 59600
  • Tissue specificity: Detected in monocytes and neutrophils (at protein level). Expressed predominantly in cells of the myeloid and B-lymphoid lineages. Highly expressed in granulocytes. Detected in tonsil. {ECO
• Sequence:

  MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIRE
  AGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGIS
  RKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDH
  YKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
  AFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQR
  NYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEI
  VTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQ
  P

• Structural information:
  • Protein Domains: (78..13-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (144..24-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (262..51-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR035851  IPR011009  IPR000719  IPR017441  IPR001245   IPR000980  IPR036860  IPR036028  IPR001452  IPR008266  IPR020635  
  • Prosite: PS00107 PS50011 PS00109 PS50001 PS50002
  • CDD: cd10363
  • PDB: 1AD5 1BU1 1QCF 2C0I 2C0O 2C0T 2HCK 2HK5 2OI3 2OJ2 3HCK 3NHN 3RBB 3REA 3REB 3VRY 3VRZ 3VS0 3VS1 3VS2 3VS3 3VS4 3VS5 3VS6 3VS7 4HCK 4LUD 4LUE 4ORZ 4U5W 5H09 5H0B 5H0E 5H0G 5H0H 5HCK 5NUH 5ZJ6
  • PDBsum: 1AD5 1BU1 1QCF 2C0I 2C0O 2C0T 2HCK 2HK5 2OI3 2OJ2 3HCK 3NHN 3RBB 3REA 3REB 3VRY 3VRZ 3VS0 3VS1 3VS2 3VS3 3VS4 3VS5 3VS6 3VS7 4HCK 4LUD 4LUE 4ORZ 4U5W 5H09 5H0B 5H0E 5H0G 5H0H 5HCK 5NUH 5ZJ6
  • DIP: 1051
  • STRING: ENSP00000444986
• Other Databases: GeneCards:  HCK  Malacards:  HCK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0038083	peptidyl-tyrosine autophosphorylation	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IBA	molecular function
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IBA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0071801	regulation of podosome assembly	IDA	biological process
GO:0005764	lysosome	IDA	cellular component
GO:2000251	positive regulation of actin cytoskeleton reorganization	IDA	biological process
GO:0005884	actin filament	IDA	colocalizes with
GO:0051090	regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0050727	regulation of inflammatory response	TAS	biological process
GO:0046777	protein autophosphorylation	IMP	biological process
GO:0045728	respiratory burst after phagocytosis	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IMP	biological process
GO:0008360	regulation of cell shape	IMP	biological process
GO:0008360	regulation of cell shape	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0007229	integrin-mediated signaling pathway	TAS	biological process
GO:0004713	protein tyrosine kinase activity	IMP	molecular function
GO:0002758	innate immune response-activating signal transduction	TAS	biological process
GO:0002522	leukocyte migration involved in immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:2000251	positive regulation of actin cytoskeleton reorganization	IMP	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0050764	regulation of phagocytosis	IMP	biological process
GO:0043299	leukocyte degranulation	TAS	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	TAS	biological process
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IMP	cellular component
GO:0030838	positive regulation of actin filament polymerization	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0005925	focal adhesion	IMP	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006909	phagocytosis	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006887	exocytosis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007498	mesoderm development	TAS	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0050690	regulation of defense response to virus by virus	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005925	focal adhesion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0030133	transport vesicle	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005901	caveola	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0001784	phosphotyrosine residue binding	IPI	molecular function
GO:0005901	caveola	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04062	Chemokine signaling pathway
hsa05130	Pathogenic Escherichia coli infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04666	Fc gamma R-mediated phagocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881