• Gene id: 3049

Gene Summary

• Gene Symbol: HBQ1   Gene   UCSC   Ensembl
• Aliases: HBQ
• Gene name: hemoglobin subunit theta 1
• Alternate names: hemoglobin subunit theta-1, hemoglobin theta-1 chain, hemoglobin, theta 1, theta-1-globin,
• Gene location: 16p13.3 (180458: 181178)     Exons: 3     NC_000016.10
• Gene summary(Entrez): Theta-globin mRNA is found in human fetal erythroid tissue but not in adult erythroid or other nonerythroid tissue. The theta-1 gene may be expressed very early in embryonic life, perhaps sometime before 5 weeks. Theta-1 is a member of the human alpha-glo
• OMIM: 608015

Protein Summary

• Protein general information: P09105  
  • Name: Hemoglobin subunit theta 1 (Hemoglobin theta 1 chain) (Theta 1 globin)
  • Length: 142  
  • Mass: 15508
• Sequence:

  MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLD
  DLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR

• Structural information:
  • Interpro: IPR000971  IPR009050  IPR012292  IPR002338  IPR002339  
  • Prosite: PS01033
  • CDD: cd08927
  • STRING: ENSP00000199708
• Other Databases: GeneCards:  HBQ1  Malacards:  HBQ1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043177	organic acid binding	IBA	molecular function
GO:0020037	heme binding	IBA	molecular function
GO:0005833	hemoglobin complex	IBA	cellular component
GO:0005344	oxygen carrier activity	IBA	molecular function
GO:0004601	peroxidase activity	IBA	contributes to
GO:0042744	hydrogen peroxide catabolic process	IBA	biological process
GO:0031838	haptoglobin-hemoglobin complex	IBA	cellular component
GO:0031720	haptoglobin binding	IBA	contributes to
GO:0019825	oxygen binding	IBA	molecular function
GO:0005506	iron ion binding	IEA	molecular function
GO:0005833	hemoglobin complex	IEA	cellular component
GO:0020037	heme binding	IEA	molecular function
GO:0015671	oxygen transport	IEA	biological process
GO:0019825	oxygen binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005344	oxygen carrier activity	IEA	molecular function
GO:0015671	oxygen transport	IEA	biological process
GO:0015671	oxygen transport	TAS	biological process
GO:0005833	hemoglobin complex	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098869	cellular oxidant detoxification	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq