• Gene id: 3038

Gene Summary

• Gene Symbol: HAS3   Gene   UCSC   Ensembl
• Gene name: hyaluronan synthase 3
• Alternate names: hyaluronan synthase 3, HA synthase 3, hyaluronate synthase 3, hyaluronic acid synthase 3,
• Gene location: 16q22.1 (69105652: 69118718)     Exons: 8     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. This gene is a member of the NODC/HAS gene family. Compared to the
• OMIM: 611398

Protein Summary

• Protein general information: O00219  
  • Name: Hyaluronan synthase 3 (EC 2.4.1.212) (Hyaluronate synthase 3) (Hyaluronic acid synthase 3) (HA synthase 3)
  • Length: 553  
  • Mass: 62998
• Sequence:

  MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQSLFAFLEHRRMRRAGQ
  ALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVLGGTEQAGFFV
  WRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACT
  IEMLRVLEEDPQVGGVGGDVQILNKYDSWISFLSSVRYWMAFNVERACQSYFGCVQCISGPLGMYRNSLLQQFLE
  DWYHQKFLGSKCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTKYLRWLNQQTRWSKSYFREWLYNSLWFHKH
  HLWMTYESVVTGFFPFFLIATVIQLFYRGRIWNILLFLLTVQLVGIIKATYACFLRGNAEMIFMSLYSLLYMSSL
  LPAKIFAIATINKSGWGTSGRKTIVVNFIGLIPVSIWVAVLLGGLAYTAYCQDLFSETELAFLVSGAILYGCYWV
  ALLMLYLAIIARRCGKKPEQYSLAFAEV

• Structural information:
  • Interpro: IPR029044  
  • STRING: ENSP00000304440
• Other Databases: GeneCards:  HAS3  Malacards:  HAS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050501	hyaluronan synthase activity	IBA	molecular function
GO:0030213	hyaluronan biosynthetic process	IBA	biological process
GO:0085029	extracellular matrix assembly	IBA	biological process
GO:0045226	extracellular polysaccharide biosynthetic process	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0085029	extracellular matrix assembly	ISS	biological process
GO:0045226	extracellular polysaccharide biosynthetic process	ISS	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0050501	hyaluronan synthase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0030213	hyaluronan biosynthetic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030213	hyaluronan biosynthetic process	IEA	biological process
GO:0050501	hyaluronan synthase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045226	extracellular polysaccharide biosynthetic process	IEA	biological process
GO:0085029	extracellular matrix assembly	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030213	hyaluronan biosynthetic process	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:1900106	positive regulation of hyaluranon cable assembly	IDA	biological process
GO:0036117	hyaluranon cable	IDA	cellular component
GO:0050501	hyaluronan synthase activity	IDA	molecular function
GO:0030213	hyaluronan biosynthetic process	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq