• Gene id: 3037

Gene Summary

• Gene Symbol: HAS2   Gene   UCSC   Ensembl
• Gene name: hyaluronan synthase 2
• Alternate names: hyaluronan synthase 2, HA synthase 2, hyaluronate synthase 2, hyaluronic acid synthase 2,
• Gene location: 8q24.13 (121641439: 121612115)     Exons: 4     NC_000008.11
• Gene summary(Entrez): Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and
• OMIM: 601636

Protein Summary

• Protein general information: Q92819  
  • Name: Hyaluronan synthase 2 (EC 2.4.1.212) (Hyaluronate synthase 2) (Hyaluronic acid synthase 2) (HA synthase 2)
  • Length: 552  
  • Mass: 63566
  • Tissue specificity: Expressed in fibroblasts.
• Sequence:

  MHCERFLCILRIIGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFSFGLYGAFLASHLIIQSLFAFLEHRKMKKSL
  ETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSEDDLYMMDIFSEVMGRDKSATYIWKN
  NFHEKGPGETDESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEM
  VKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWY
  NQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHLW
  MTYEAIITGFFPFFLIATVIQLFYRGKIWNILLFLLTVQLVGLIKSSFASCLRGNIVMVFMSLYSVLYMSSLLPA
  KMFAIATINKAGWGTSGRKTIVVNFIGLIPVSVWFTILLGGVIFTIYKESKRPFSESKQTVLIVGTLLYACYWVM
  LLTLYVVLINKCGRRKKGQQYDMVLDV

• Structural information:
  • Interpro: IPR028371  IPR029044  
  • STRING: ENSP00000306991
• Other Databases: GeneCards:  HAS2  Malacards:  HAS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050501	hyaluronan synthase activity	IBA	molecular function
GO:0030213	hyaluronan biosynthetic process	IBA	biological process
GO:0085029	extracellular matrix assembly	IBA	biological process
GO:0045226	extracellular polysaccharide biosynthetic process	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0036302	atrioventricular canal development	ISS	biological process
GO:0001570	vasculogenesis	ISS	biological process
GO:0090500	endocardial cushion to mesenchymal transition	ISS	biological process
GO:0085029	extracellular matrix assembly	ISS	biological process
GO:0045226	extracellular polysaccharide biosynthetic process	ISS	biological process
GO:0030213	hyaluronan biosynthetic process	IEA	biological process
GO:0050501	hyaluronan synthase activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050501	hyaluronan synthase activity	IEA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001822	kidney development	IEA	biological process
GO:0030213	hyaluronan biosynthetic process	IEA	biological process
GO:0050501	hyaluronan synthase activity	IEA	molecular function
GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	IEA	biological process
GO:1900127	positive regulation of hyaluronan biosynthetic process	IEA	biological process
GO:0001570	vasculogenesis	IEA	biological process
GO:0030212	hyaluronan metabolic process	IEA	biological process
GO:0030213	hyaluronan biosynthetic process	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0036302	atrioventricular canal development	IEA	biological process
GO:0050501	hyaluronan synthase activity	IEA	molecular function
GO:0010838	positive regulation of keratinocyte proliferation	IEA	biological process
GO:0014911	positive regulation of smooth muscle cell migration	IEA	biological process
GO:0035810	positive regulation of urine volume	IEA	biological process
GO:0044849	estrous cycle	IEA	biological process
GO:0051549	positive regulation of keratinocyte migration	IEA	biological process
GO:0070295	renal water absorption	IEA	biological process
GO:1901201	regulation of extracellular matrix assembly	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0044853	plasma membrane raft	IEA	cellular component
GO:0045226	extracellular polysaccharide biosynthetic process	IEA	biological process
GO:0060349	bone morphogenesis	IEA	biological process
GO:0085029	extracellular matrix assembly	IEA	biological process
GO:0090500	endocardial cushion to mesenchymal transition	IEA	biological process
GO:0050501	hyaluronan synthase activity	IMP	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0030213	hyaluronan biosynthetic process	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0071356	cellular response to tumor necrosis factor	IEP	biological process
GO:0071347	cellular response to interleukin-1	IEP	biological process
GO:0071498	cellular response to fluid shear stress	IEP	biological process
GO:1900625	positive regulation of monocyte aggregation	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030213	hyaluronan biosynthetic process	IEA	biological process
GO:0036120	cellular response to platelet-derived growth factor stimulus	IDA	biological process
GO:0030213	hyaluronan biosynthetic process	IDA	biological process
GO:0070295	renal water absorption	ISS	biological process
GO:0050501	hyaluronan synthase activity	ISS	molecular function
GO:0001822	kidney development	ISS	biological process
GO:0035810	positive regulation of urine volume	ISS	biological process
GO:0030213	hyaluronan biosynthetic process	ISS	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray