• Gene id: 3026

Gene Summary

• Gene Symbol: HABP2   Gene   UCSC   Ensembl
• Aliases: FSAP, HABP, HGFAL, NMTC5, PHBP
• Gene name: hyaluronan binding protein 2
• Alternate names: hyaluronan-binding protein 2, factor VII activating protein, factor VII-activating protease, factor seven-activating protease, hepatocyte growth factor activator-like protein, hyaluronic acid binding protein 2, plasma hyaluronan binding protein,
• Gene location: 10q25.3 (113550830: 113589601)     Exons: 14     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by hepatocytes and proteolytically processed to generate heavy and light chains that form the mature heterodimer. Further autoproteolysis lead
• OMIM: 609695

Protein Summary

• Protein general information: Q14520  
  • Name: Hyaluronan binding protein 2 (EC 3.4.21. ) (Factor VII activating protease) (Factor seven activating protease) (FSAP) (Hepatocyte growth factor activator like protein) (Plasma hyaluronan binding protein) [Cleaved into: Hyaluronan binding protein 2 50 kDa
  • Length: 560  
  • Mass: 62672
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MFARMSDLHVLLLMALVGKTACGFSLMSLLESLDPDWTPDQYDYSYEDYNQEENTSSTLTHAENPDWYYTEDQAD
  PCQPNPCEHGGDCLVHGSTFTCSCLAPFSGNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCKHPYTGPSCSQV
  VPVCRPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCYVGDGYSYRGKMNRTVNQHACLYWNSHLLLQ
  ENYNMFMEDAETHGIGEHNFCRNPDADEKPWCFIKVTNDKVKWEYCDVSACSAQDVAYPEESPTEPSTKLPGFDS
  CGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHFCGGALIHPCWVLTAAHCTDIKTRHLKVVL
  GDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPVDGHCALESKYVKTVCLPDGSFPSGSECHIS
  GWGVTETGKGSRQLLDAKVKLIANTLCNSRQLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYG
  IVSWGLECGKRPGVYTQVTKFLNWIKATIKSESGF

• Structural information:
  • Protein Domains: (73..10-)
    (/note="EGF-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (111..14-)
    (/note="EGF-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (150..18-)
    (/note="EGF-like-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:-)
  • Interpro: IPR001881  IPR013032  IPR000742  IPR000001  IPR013806   IPR018056  IPR038178  IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  
  • Prosite: PS00022 PS01186 PS50026 PS00021 PS50070 PS50240 PS00134 PS00135
  • CDD: cd00108 cd00190
  • STRING: ENSP00000277903
• Other Databases: GeneCards:  HABP2  Malacards:  HABP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0004252	serine-type endopeptidase activity	IBA	molecular function
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0005539	glycosaminoglycan binding	TAS	molecular function
GO:0007155	cell adhesion	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0008233	peptidase activity	IDA	molecular function
GO:0006508	proteolysis	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	NAS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq