• Gene id: 302

Gene Summary

• Gene Symbol: ANXA2   Gene   UCSC   Ensembl
• Aliases: ANX2, ANX2L4, CAL1H, HEL-S-270, LIP2, LPC2, LPC2D, P36, PAP-IV
• Gene name: annexin A2
• Alternate names: annexin A2, annexin II, annexin-2, calpactin I heavy chain, calpactin I heavy polypeptide, calpactin-1 heavy chain, chromobindin 8, epididymis secretory protein Li 270, lipocortin II, placental anticoagulant protein IV, protein I,
• Gene location: 15q22.2 (60398024: 60347150)     Exons: 16     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor whi
• OMIM: 151740

Protein Summary

• Protein general information: P07355  
  • Name: Annexin A2 (Annexin II) (Annexin 2) (Calpactin I heavy chain) (Calpactin 1 heavy chain) (Chromobindin 8) (Lipocortin II) (Placental anticoagulant protein IV) (PAP IV) (Protein I) (p36)
  • Length: 339  
  • Mass: 38,604
• Sequence:

  MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAY
  QRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEM
  YKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHL
  QKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDM
  LKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

• Structural information:
  • Interpro: IPR001464  IPR018502  IPR018252  IPR037104  IPR002389  
  • Prosite: PS00223
  • PDB: 1W7B 1XJL 2HYU 2HYV 2HYW 4DRW 4FTG 4HRH 5LPU 5LPX 5LQ0 5LQ2 5N7D 5N7F 5N7G
  • PDBsum: 1W7B 1XJL 2HYU 2HYV 2HYW 4DRW 4FTG 4HRH 5LPU 5LPX 5LQ0 5LQ2 5N7D 5N7F 5N7G
  • STRING: ENSP00000346032
• Other Databases: GeneCards:  ANXA2  Malacards:  ANXA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEP	biological process
GO:0001726	ruffle	IEA	cellular component
GO:0001765	membrane raft assembly	IMP	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0002091	negative regulation of receptor internalization	IDA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005544	calcium-dependent phospholipid binding	IDA	molecular function
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IMP	molecular function
GO:0005604	basement membrane	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005811	lipid particle	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0006900	membrane budding	IMP	biological process
GO:0007589	body fluid secretion	IEA	biological process
GO:0008092	cytoskeletal protein binding	IEA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0019834	phospholipase A2 inhibitor activity	IDA	molecular function
GO:0019897	extrinsic component of plasma membrane	IEA	cellular component
GO:0030199	collagen fibril organization	IEA	biological process
GO:0030496	midbody	IDA	cellular component
GO:0031340	positive regulation of vesicle fusion	IDA	biological process
GO:0031902	late endosome membrane	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0032804	negative regulation of low-density lipoprotein particle receptor catabolic process	IDA	biological process
GO:0035749	myelin sheath adaxonal region	IEA	cellular component
GO:0036035	osteoclast development	IDA	biological process
GO:0042383	sarcolemma	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0042730	fibrinolysis	IEA	biological process
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0043220	Schmidt-Lanterman incisure	IEA	cellular component
GO:0044354	macropinosome	IEA	cellular component
GO:0044548	S100 protein binding	IPI	molecular function
GO:0044548	S100 protein binding	IPI	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0048146	positive regulation of fibroblast proliferation	IEA	biological process
GO:0048306	calcium-dependent protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0051099	positive regulation of binding	IEA	biological process
GO:0051290	protein heterotetramerization	IDA	biological process
GO:0051290	protein heterotetramerization	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072661	protein targeting to plasma membrane	IEA	biological process
GO:0097066	response to thyroid hormone	IEA	biological process
GO:1900121	negative regulation of receptor binding	IDA	biological process
GO:1990667	PCSK9-AnxA2 complex	IDA	cellular component
GO:2000273	positive regulation of receptor activity	IMP	biological process
GO:0031012	extracellular matrix	ISS	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0030546	receptor activator activity	IDA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0001525	angiogenesis	IEP	biological process
GO:0001726	ruffle	IEA	cellular component
GO:0001765	membrane raft assembly	IMP	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0002091	negative regulation of receptor internalization	IEA	biological process
GO:0002091	negative regulation of receptor internalization	IDA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0004859	phospholipase inhibitor activity	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0005544	calcium-dependent phospholipid binding	IDA	molecular function
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IEA	molecular function
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IMP	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005604	basement membrane	IEA	cellular component
GO:0005604	basement membrane	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005811	lipid particle	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0006900	membrane budding	IMP	biological process
GO:0007589	body fluid secretion	IEA	biological process
GO:0008092	cytoskeletal protein binding	IEA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0019834	phospholipase A2 inhibitor activity	IDA	molecular function
GO:0019897	extrinsic component of plasma membrane	IEA	cellular component
GO:0030199	collagen fibril organization	IEA	biological process
GO:0030496	midbody	IDA	cellular component
GO:0031340	positive regulation of vesicle fusion	IDA	biological process
GO:0031902	late endosome membrane	IDA	cellular component
GO:0031982	vesicle	IEA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0032804	negative regulation of low-density lipoprotein particle receptor catabolic process	IEA	biological process
GO:0032804	negative regulation of low-density lipoprotein particle receptor catabolic process	IDA	biological process
GO:0035749	myelin sheath adaxonal region	IEA	cellular component
GO:0036035	osteoclast development	IDA	biological process
GO:0042383	sarcolemma	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0042730	fibrinolysis	IEA	biological process
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0043220	Schmidt-Lanterman incisure	IEA	cellular component
GO:0043234	protein complex	IEA	cellular component
GO:0044354	macropinosome	IEA	cellular component
GO:0044548	S100 protein binding	IPI	molecular function
GO:0044548	S100 protein binding	IPI	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0048146	positive regulation of fibroblast proliferation	IEA	biological process
GO:0048306	calcium-dependent protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0051099	positive regulation of binding	IEA	biological process
GO:0051290	protein heterotetramerization	IDA	biological process
GO:0051290	protein heterotetramerization	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072661	protein targeting to plasma membrane	IEA	biological process
GO:0097066	response to thyroid hormone	IEA	biological process
GO:1900121	negative regulation of receptor binding	IEA	biological process
GO:1900121	negative regulation of receptor binding	IDA	biological process
GO:1990667	PCSK9-AnxA2 complex	IDA	cellular component
GO:2000273	positive regulation of receptor activity	IEA	biological process
GO:2000273	positive regulation of receptor activity	IMP	biological process
GO:0031012	extracellular matrix	ISS	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0030546	receptor activator activity	IDA	molecular function
GO:0001525	angiogenesis	IEP	biological process
GO:0001765	membrane raft assembly	IMP	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0002091	negative regulation of receptor internalization	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005544	calcium-dependent phospholipid binding	IDA	molecular function
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IMP	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005811	lipid particle	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006900	membrane budding	IMP	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0019834	phospholipase A2 inhibitor activity	IDA	molecular function
GO:0030496	midbody	IDA	cellular component
GO:0031340	positive regulation of vesicle fusion	IDA	biological process
GO:0031902	late endosome membrane	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0032804	negative regulation of low-density lipoprotein particle receptor catabolic process	IDA	biological process
GO:0036035	osteoclast development	IDA	biological process
GO:0044548	S100 protein binding	IPI	molecular function
GO:0044548	S100 protein binding	IPI	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0048306	calcium-dependent protein binding	IPI	molecular function
GO:0051290	protein heterotetramerization	IDA	biological process
GO:0051290	protein heterotetramerization	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:1900121	negative regulation of receptor binding	IDA	biological process
GO:1990667	PCSK9-AnxA2 complex	IDA	cellular component
GO:2000273	positive regulation of receptor activity	IMP	biological process
GO:0031012	extracellular matrix	ISS	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0030546	receptor activator activity	IDA	molecular function

Diseases

Associated diseases	References
Cancer (prostate)	GAD: 20540360
Osteonecrosis	GAD: 15784727
Osteonecrosis	GAD: 15784727
Endometriosis	INFBASE: 23340055
Male factor infertility	MIK: 22353264
Asthenozoospermia	MIK: 22353264
Adenomyosis	INFBASE: 22493182
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 22353264
Cryptorchidism	MIK: 28606200
Male subfertility	MIK: 28681403
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22353264	Asthenozoospermia				Male infertility	ANXA2 BRD2 OAZ3
28681403	Male subfertility	Methylation		78 (28 proven fertile males "controls," and 50 subfertile males "cases")	Male infertility	PRRC2A ANXA2 MAPK8IP3
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R