• Gene id: 3018

Gene Summary

• Gene Symbol: H2BC3   Gene   UCSC   Ensembl
• Aliases: H2B.1, H2B/f, H2BFF, HIST1H2BB
• Gene name: H2B clustered histone 3
• Alternate names: histone H2B type 1-B, H2B histone family, member F, histone 1, H2bb, histone H2B.1, histone H2B.f, histone cluster 1 H2B family member b, histone cluster 1, H2bb,
• Gene location: 6p22.2 (26043712: 26043226)     Exons: 1     NC_000006.12
• Gene summary(Entrez): Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core hi
• OMIM: 602803

Protein Summary

• Protein general information: P33778  
  • Name: Histone H2B type 1 B (H2B clustered histone 3) (Histone H2B.1) (Histone H2B.f) (H2B/f)
  • Length: 126  
  • Mass: 13950
• Sequence:

  MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIA
  GEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

• Structural information:
  • Interpro: IPR009072  IPR007125  IPR000558  
  • Prosite: PS00357
  • PDB: 3X1S 3X1U
  • PDBsum: 3X1S 3X1U
  • DIP: 47505
  • STRING: ENSP00000482674
• Other Databases: GeneCards:  H2BC3  Malacards:  H2BC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006334	nucleosome assembly	IBA	biological process
GO:0003677	DNA binding	IBA	molecular function
GO:0000786	nucleosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0000786	nucleosome	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006334	nucleosome assembly	NAS	biological process
GO:0000786	nucleosome	NAS	cellular component
GO:0003677	DNA binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05034	Alcoholism
hsa05203	Viral carcinogenesis
hsa05322	Systemic lupus erythematosus

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)