• Gene id: 3013

Gene Summary

• Gene Symbol: H2AC7   Gene   UCSC   Ensembl
• Aliases: H2A.3, H2A/g, H2AFG, HIST1H2AD
• Gene name: H2A clustered histone 7
• Alternate names: histone H2A type 1-D, H2A histone family, member G, histone 1, H2ad, histone H2A.3, histone H2A/g, histone H2AD, histone cluster 1 H2A family member d, histone cluster 1, H2ad,
• Gene location: 6p22.2 (26199292: 26198783)     Exons: 1     NC_000006.12
• Gene summary(Entrez): Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the f
• OMIM: 602792

Protein Summary

• Protein general information: P20671  
  • Name: Histone H2A type 1 D (Histone H2A.3) (Histone H2A/g)
  • Length: 130  
  • Mass: 14107
• Sequence:

  MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNK
  KTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

• Structural information:
  • Interpro: IPR009072  IPR002119  IPR007125  IPR032454  IPR032458  
  • Prosite: PS00046
  • CDD: cd00074
  • PDB: 5GT3
  • PDBsum: 5GT3
  • STRING: ENSP00000341094
• Other Databases: GeneCards:  H2AC7  Malacards:  H2AC7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006342	chromatin silencing	IBA	biological process
GO:0003677	DNA binding	IBA	molecular function
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0006325	chromatin organization	IBA	biological process
GO:0000786	nucleosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0000786	nucleosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005634	nucleus	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05034	Alcoholism
hsa04217	Necroptosis
hsa05322	Systemic lupus erythematosus

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)