About Us

Search Result


Gene id 3013
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol H2AC7   Gene   UCSC   Ensembl
Aliases H2A.3, H2A/g, H2AFG, HIST1H2AD
Gene name H2A clustered histone 7
Alternate names histone H2A type 1-D, H2A histone family, member G, histone 1, H2ad, histone H2A.3, histone H2A/g, histone H2AD, histone cluster 1 H2A family member d, histone cluster 1, H2ad,
Gene location 6p22.2 (26199292: 26198783)     Exons: 1     NC_000006.12
Gene summary(Entrez) Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the f
OMIM 602792

Protein Summary

Protein general information P20671  

Name: Histone H2A type 1 D (Histone H2A.3) (Histone H2A/g)

Length: 130  Mass: 14107

Sequence MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNK
KTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Structural information
Interpro:  IPR009072  IPR002119  IPR007125  IPR032454  IPR032458  
Prosite:   PS00046
CDD:   cd00074

PDB:  
5GT3
PDBsum:   5GT3
MINT:  
STRING:   ENSP00000341094
Other Databases GeneCards:  H2AC7  Malacards:  H2AC7

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0006342 chromatin silencing
IBA biological process
GO:0003677 DNA binding
IBA molecular function
GO:0000790 nuclear chromatin
IBA cellular component
GO:0006325 chromatin organization
IBA biological process
GO:0000786 nucleosome
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0046982 protein heterodimerizatio
n activity
IEA molecular function
GO:0000786 nucleosome
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005694 chromosome
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0005694 chromosome
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005634 nucleus
IDA cellular component
GO:0005634 nucleus
IDA cellular component
GO:0008150 biological_process
ND biological process
GO:0003674 molecular_function
ND molecular function
GO:0005634 nucleus
HDA cellular component
GO:0070062 extracellular exosome
HDA cellular component
GO:0070062 extracellular exosome
HDA cellular component
GO:0070062 extracellular exosome
HDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05034Alcoholism
hsa04217Necroptosis
hsa05322Systemic lupus erythematosus
Associated diseases References
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract