• Gene id: 3009

Gene Summary

• Gene Symbol: H1-5   Gene   UCSC   Ensembl
• Aliases: H1, H1.5, H1B, H1F5, H1s-3, HIST1H1B
• Gene name: H1.5 linker histone, cluster member
• Alternate names: histone H1.5, H1 histone family, member 5, histone 1, H1b, histone H1a, histone H1b, histone H1s-3, histone cluster 1 H1 family member b, histone cluster 1, H1b,
• Gene location: 6p22.1 (27867587: 27866791)     Exons: 1     NC_000006.12
• Gene summary(Entrez): Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in
• OMIM: 601739

Protein Summary

• Protein general information: P16401  
  • Name: Histone H1.5 (Histone H1a) (Histone H1b) (Histone H1s 3)
  • Length: 226  
  • Mass: 22580
  • Tissue specificity: Ubiquitous. Expressed in the majority of the cell lines tested and in testis. {ECO
• Sequence:

  MSETAPAETATPAPVEKSPAKKKATKKAAGAGAAKRKATGPPVSELITKAVAASKERNGLSLAALKKALAAGGYD
  VEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGATPKKAKKAAGAKK
  AVKKTPKKAKKPAAAGVKKVAKSPKKAKAAAKPKKATKSPAKPKAVKPKAAKPKAAKPKAAKPKAAKAKKAAAKK
  K

• Structural information:
  • Protein Domains: (39..11-)
    (/note="H15-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00837"-)
  • Interpro: IPR005818  IPR005819  IPR036388  IPR036390  
  • Prosite: PS51504
  • CDD: cd00073
  • PDB: 2FE2 2RHI
  • PDBsum: 2FE2 2RHI
  • STRING: ENSP00000330074
• Other Databases: GeneCards:  H1-5  Malacards:  H1-5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003690	double-stranded DNA binding	IBA	molecular function
GO:0030261	chromosome condensation	IBA	biological process
GO:0031492	nucleosomal DNA binding	IBA	molecular function
GO:0045910	negative regulation of DNA recombination	IBA	biological process
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005719	nuclear euchromatin	IBA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0016584	nucleosome positioning	IBA	biological process
GO:0031936	negative regulation of chromatin silencing	IBA	biological process
GO:0000786	nucleosome	IEA	cellular component
GO:0006334	nucleosome assembly	IEA	biological process
GO:0042025	host cell nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007517	muscle organ development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005720	nuclear heterochromatin	IDA	cellular component
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0050821	protein stabilization	IMP	biological process
GO:0071169	establishment of protein localization to chromatin	IMP	biological process
GO:0031490	chromatin DNA binding	IMP	molecular function
GO:0006325	chromatin organization	IMP	biological process
GO:0051574	positive regulation of histone H3-K9 methylation	IMP	biological process
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0031490	chromatin DNA binding	IMP	molecular function
GO:0030307	positive regulation of cell growth	IMP	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881