• Gene id: 3005

Gene Summary

• Gene Symbol: H1-0   Gene   UCSC   Ensembl
• Aliases: H1.0, H10, H1F0, H1FV
• Gene name: H1.0 linker histone
• Alternate names: histone H1.0, H1 histone family member 0, H1.0, H1(0), H1-0, histone H1', histone H1(0),
• Gene location: 22q13.1 (37805228: 37807431)     Exons: 1     NC_000022.11
• Gene summary(Entrez): Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core hi
• OMIM: 142708

Protein Summary

• Protein general information: P07305  
  • Name: Histone H1.0 (Histone H1') (Histone H1(0)) [Cleaved into: Histone H1.0, N terminally processed]
  • Length: 194  
  • Mass: 20863
• Sequence:

  MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRL
  VTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKL
  AATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

• Structural information:
  • Protein Domains: (24..9-)
    (/note="H15-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00837"-)
  • Interpro: IPR005818  IPR005819  IPR036388  IPR036390  
  • Prosite: PS51504
  • CDD: cd00073
  • PDB: 6HQ1 6N88 6N89
  • PDBsum: 6HQ1 6N88 6N89
  • DIP: 41775
  • STRING: ENSP00000344504
• Other Databases: GeneCards:  H1-0  Malacards:  H1-0

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045910	negative regulation of DNA recombination	IBA	biological process
GO:0031492	nucleosomal DNA binding	IBA	molecular function
GO:0030261	chromosome condensation	IBA	biological process
GO:0003690	double-stranded DNA binding	IBA	molecular function
GO:0031936	negative regulation of chromatin silencing	IBA	biological process
GO:0016584	nucleosome positioning	IBA	biological process
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000786	nucleosome	IEA	cellular component
GO:0006334	nucleosome assembly	IEA	biological process
GO:0042025	host cell nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006309	apoptotic DNA fragmentation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003680	AT DNA binding	IEA	molecular function
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0031490	chromatin DNA binding	IDA	molecular function
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0005719	nuclear euchromatin	IDA	cellular component
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:2000679	positive regulation of transcription regulatory region DNA binding	IMP	biological process
GO:0006342	chromatin silencing	IGI	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IGI	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)