• Gene id: 3001

Gene Summary

• Gene Symbol: GZMA   Gene   UCSC   Ensembl
• Aliases: CTLA3, HFSP
• Gene name: granzyme A
• Alternate names: granzyme A, CTL tryptase, Cytotoxic T-lymphocyte-associated serine esterase-3, Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factor serine protease), HF, Hanukah factor serine protease), cytotoxic T-lymphocyte proteinase 1, fragmentin-,
• Gene location: 5q11.2 (55102645: 55110251)     Exons: 5     NC_000005.10
• Gene summary(Entrez): Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptid
• OMIM: 603950

Protein Summary

• Protein general information: P12544  
  • Name: Granzyme A (EC 3.4.21.78) (CTL tryptase) (Cytotoxic T lymphocyte proteinase 1) (Fragmentin 1) (Granzyme 1) (Hanukkah factor) (H factor) (HF)
  • Length: 262  
  • Mass: 28999
• Sequence:

  MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKR
  SQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQV
  AGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGV
  TSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV

• Structural information:
  • Protein Domains: (29..25-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50240 PS00134 PS00135
  • CDD: cd00190
  • PDB: 1HF1 1OP8 1ORF
  • PDBsum: 1HF1 1OP8 1ORF
  • STRING: ENSP00000274306
• Other Databases: GeneCards:  GZMA  Malacards:  GZMA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051354	negative regulation of oxidoreductase activity	IBA	biological process
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0051603	proteolysis involved in cellular protein catabolic process	IDA	biological process
GO:0051354	negative regulation of oxidoreductase activity	IDA	biological process
GO:0043392	negative regulation of DNA binding	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0032078	negative regulation of endodeoxyribonuclease activity	IDA	biological process
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0019835	cytolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0001772	immunological synapse	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0051354	negative regulation of oxidoreductase activity	IBA	biological process
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0051603	proteolysis involved in cellular protein catabolic process	IDA	biological process
GO:0051354	negative regulation of oxidoreductase activity	IDA	biological process
GO:0043392	negative regulation of DNA binding	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0032078	negative regulation of endodeoxyribonuclease activity	IDA	biological process
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0019835	cytolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0001772	immunological synapse	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Chronic obstructive pulmonary disease	PMID:20047264
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R