• Gene id: 30001

Gene Summary

• Gene Symbol: ERO1A   Gene   UCSC   Ensembl
• Aliases: ERO1-L, ERO1-L-alpha, ERO1-alpha, ERO1L, ERO1LA, Ero1alpha
• Gene name: endoplasmic reticulum oxidoreductase 1 alpha
• Alternate names: ERO1-like protein alpha, endoplasmic oxidoreductin-1-like protein, endoplasmic reticulum oxidoreductase alpha, oxidoreductin-1-L-alpha,
• Gene location: 14q22.1 (52695749: 52639914)     Exons: 16     NC_000014.9
• OMIM: 615435

Protein Summary

• Protein general information: Q96HE7  
  • Name: ERO1 like protein alpha (ERO1 L) (ERO1 L alpha) (EC 1.8.4. ) (Endoplasmic oxidoreductin 1 like protein) (Endoplasmic reticulum oxidoreductase alpha) (Oxidoreductin 1 L alpha)
  • Length: 468  
  • Mass: 54393
  • Tissue specificity: Widely expressed at low level. Expressed at high level in upper digestive tract. Highly expressed in esophagus. Weakly expressed in stomach and duodenum. {ECO
• Sequence:

  MGRGWGFLFGLLGAVWLLSSGHGEEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYRLFPRLQKLLESDYFR
  YYKVNLKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQK
  AVLQWTKHDDSSDNFCEADDIQSPEAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLNPLASGQ
  GTSEENTFYSWLEGLCVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHNITEFQQRFDGILTEGEGPRR
  LKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEILHEIKSFPLHFDENSFFAGDKKEAHKLK
  EDFRLHFRNISRIMDCVGCFKCRLWGKLQTQGLGTALKILFSEKLIANMPESGPSYEFHLTRQEIVSLFNAFGRI
  STSVKELENFRNLLQNIH

• Structural information:
  • Interpro: IPR007266  IPR037192  
  • PDB: 3AHQ 3AHR
  • PDBsum: 3AHQ 3AHR
  • STRING: ENSP00000379042
• Other Databases: GeneCards:  ERO1A  Malacards:  ERO1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015035	protein disulfide oxidoreductase activity	IBA	molecular function
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0034975	protein folding in endoplasmic reticulum	IBA	biological process
GO:0003756	protein disulfide isomerase activity	IBA	molecular function
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	ISS	biological process
GO:0051209	release of sequestered calcium ion into cytosol	ISS	biological process
GO:0034976	response to endoplasmic reticulum stress	ISS	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016671	oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0003756	protein disulfide isomerase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016020	membrane	TAS	cellular component
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0006464	cellular protein modification process	TAS	biological process
GO:0009266	response to temperature stimulus	TAS	biological process
GO:0043231	intracellular membrane-bounded organelle	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0034599	cellular response to oxidative stress	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051209	release of sequestered calcium ion into cytosol	IEA	biological process
GO:0045454	cell redox homeostasis	IEA	biological process
GO:0034976	response to endoplasmic reticulum stress	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0010260	animal organ senescence	IEA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0050873	brown fat cell differentiation	IEA	biological process
GO:0030968	endoplasmic reticulum unfolded protein response	IEA	biological process
GO:0022417	protein maturation by protein folding	IEA	biological process
GO:0018401	peptidyl-proline hydroxylation to 4-hydroxy-L-proline	IEA	biological process
GO:0015035	protein disulfide oxidoreductase activity	IEA	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IDA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0051085	chaperone cofactor-dependent protein refolding	IDA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum
hsa05110	Vibrio cholerae infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881