• Gene id: 29999

Gene Summary

• Gene Symbol: FSCN3   Gene   UCSC   Ensembl
• Gene name: fascin actin-bundling protein 3
• Alternate names: fascin-3, fascin actin-bundling protein 3, testicular, fascin homolog 3, actin-bundling protein, testicular, testicular secretory protein Li 18, testis fascin,
• Gene location: 7q32.1 (127593735: 127602143)     Exons: 7     NC_000007.14
• OMIM: 615800

Protein Summary

• Protein general information: Q9NQT6  
  • Name: Fascin 3 (Testis fascin)
  • Length: 498  
  • Mass: 56624
  • Tissue specificity: Expressed in testis.
• Sequence:

  MDETEWIHRHPKAEDLRVGLISWAGTYLTFEACKNTVTATAKSLGRRQTWEILVSNEHETQAVVRLKSVQGLYLL
  CECDGTVCYGRPRTSHHGCFLLRFHRNSKWTLQCLISGRYLESNGKDVFCTSHVLSAYHMWTPRPALHVHVILYS
  PIHRCYARADPTMGRIWVDAAVPCLEECGFLLHFRDGCYHLETSTHHFLSHVDRLFSQPSSQTAFHMQVRPGGLV
  ALCDGEGGMLYPQGTHLLLGMGCNPMRGEEWFILQHCPTWVSLRSKTGRFISVIYDGEVRAASERLNRMSLFQFE
  CDSESPTVQLRSANGYYLSQRRHRAVMADGHPLESDTFFRMHWNCGRIILQSCRGRFLGIAPNSLLMANVILPGP
  NEEFGILFANRSFLVLRGRYGYVGSSSGHDLIQCNQDQPDRIHLLPCRPGIYHFQAQGGSFWSITSFGTFRPWGK
  FALNFCIELQGSNLLTVLAPNGFYMRADQSGTLLADSEDITRECIWEF

• Structural information:
  • Interpro: IPR008999  IPR010431  IPR022768  IPR024703  IPR030143  
  • CDD: cd00257
  • STRING: ENSP00000265825
• Other Databases: GeneCards:  FSCN3  Malacards:  FSCN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0007163	establishment or maintenance of cell polarity	IBA	biological process
GO:0030027	lamellipodium	IBA	cellular component
GO:0030426	growth cone	IBA	cellular component
GO:0051017	actin filament bundle assembly	IBA	biological process
GO:0001726	ruffle	IBA	cellular component
GO:0005902	microvillus	IBA	cellular component
GO:0015629	actin cytoskeleton	IBA	cellular component
GO:0016477	cell migration	IBA	biological process
GO:0030175	filopodium	IBA	cellular component
GO:0031253	cell projection membrane	IBA	cellular component
GO:0051015	actin filament binding	IBA	molecular function
GO:0015629	actin cytoskeleton	ISS	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0007015	actin filament organization	IEA	biological process
GO:0007286	spermatid development	IEA	biological process
GO:0051015	actin filament binding	IEA	molecular function
GO:0030674	protein-macromolecule adaptor activity	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R