• Gene id: 29995

Gene Summary

• Gene Symbol: LMCD1   Gene   UCSC   Ensembl
• Gene name: LIM and cysteine rich domains 1
• Alternate names: LIM and cysteine-rich domains protein 1, dyxin,
• Gene location: 3p25.3 (8501806: 8574667)     Exons: 7     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the LIM-domain family of zinc finger proteins. The encoded protein contains an N-terminal cysteine-rich domain and two C-terminal LIM domains. The presence of LIM domains suggests involvement in protein-protein interactions.
• OMIM: 604859

Protein Summary

• Protein general information: Q9NZU5  
  • Name: LIM and cysteine rich domains protein 1 (Dyxin)
  • Length: 365  
  • Mass: 40833
  • Tissue specificity: Expressed in the heart (at protein level). Expressed in many tissues with highest abundance in skeletal muscle. {ECO
• Sequence:

  MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMD
  SKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGA
  FYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTA
  ATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHY
  CESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS

• Structural information:
  • Protein Domains: (99..20-)
    (/note="PET-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00636-)
    (241..30-)
    1 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (307..36-)
    2 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-)
  • Interpro: IPR010442  IPR033724  IPR001781  
  • Prosite: PS00478 PS50023 PS51303
  • CDD: cd09829
  • STRING: ENSP00000157600
• Other Databases: GeneCards:  LMCD1  Malacards:  LMCD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0010611	regulation of cardiac muscle hypertrophy	IEA	biological process
GO:0070886	positive regulation of calcineurin-NFAT signaling cascade	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0070886	positive regulation of calcineurin-NFAT signaling cascade	IMP	biological process
GO:0010611	regulation of cardiac muscle hypertrophy	IMP	biological process
GO:0003714	transcription corepressor activity	ISS	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)