• Gene id: 29991

Gene Summary

• Gene Symbol: OBP2A   Gene   UCSC   Ensembl
• Aliases: LCN13, OBP, OBP2C, OBPIIa, hOBPIIa
• Gene name: odorant binding protein 2A
• Alternate names: odorant-binding protein 2a, odorant-binding protein IIa, putative odorant-binding protein 2c,
• Gene location: 9q34.3 (135544811: 135549968)     Exons: 33     NC_000009.12
• Gene summary(Entrez): This gene encodes a small extracellular protein belonging to the lipocalin superfamily. The protein is thought to transport small, hydrophobic, volatile molecules or odorants through the nasal mucus to olfactory receptors, and may also function as a scave
• OMIM: 164320

Protein Summary

• Protein general information: Q9NY56  
  • Name: Odorant binding protein 2a (Odorant binding protein IIa) (OBPIIa)
  • Length: 170  
  • Mass: 19318
  • Tissue specificity: Strongly expressed in the nasal structures, salivary and lachrymal glands, and lung.
• Sequence:

  MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCI
  QKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEALEEFKKLVQHK
  GLSEEDIFMPLQTGSCVLEH

• Structural information:
  • Interpro: IPR012674  IPR002345  IPR000566  IPR002450  
  • PDB: 4RUN
  • PDBsum: 4RUN
  • STRING: ENSP00000441028
• Other Databases: GeneCards:  OBP2A  Malacards:  OBP2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036094	small molecule binding	IEA	molecular function
GO:0050896	response to stimulus	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007608	sensory perception of smell	IEA	biological process
GO:0007606	sensory perception of chemical stimulus	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0005549	odorant binding	NAS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq