Search Result
Gene id | 2999 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Symbol | GZMH Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Aliases | CCP-X, CGL-2, CSP-C, CTLA1, CTSGL2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene name | granzyme H | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Alternate names | granzyme H, cathepsin G-like 2, protein h-CCPX, cytotoxic T-lymphocyte proteinase, cytotoxic T-lymphocyte-associated serine esterase 1, cytotoxin serine protease-C, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene location |
14q12 (24609762: 24606479) Exons: 18 NC_000014.9 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene summary(Entrez) |
This gene encodes a member of the peptidase S1 family of serine proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a chymotrypsin-like protea |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
OMIM | 116831 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein general information | P20718 Name: Granzyme H (EC 3.4.21. ) (CCP X) (Cathepsin G like 2) (CTSGL2) (Cytotoxic T lymphocyte proteinase) (Cytotoxic serine protease C) (CSP C) Length: 246 Mass: 27315 Tissue specificity: Constitutively expressed in NK cells. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequence |
MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLG AHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYV SMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTP PGVYIKVSHFLPWIKRTMKRL | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Databases | GeneCards: GZMH Malacards: GZMH | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|