• Gene id: 29988

Gene Summary

• Gene Symbol: SLC2A8   Gene   UCSC   Ensembl
• Aliases: GLUT8, GLUTX1
• Gene name: solute carrier family 2 member 8
• Alternate names: solute carrier family 2, facilitated glucose transporter member 8, glucose transporter type 8, glucose transporter type X1, solute carrier family 2 (facilitated glucose transporter), member 8,
• Gene location: 9q33.3 (127397137: 127407897)     Exons: 11     NC_000009.12
• Gene summary(Entrez): This gene belongs to the solute carrier 2A family, which includes intracellular glucose transporters. Based on sequence comparison, the glucose transporters are grouped into three classes and this gene is a member of class II. The encoded protein, like ot
• OMIM: 605245

Protein Summary

• Protein general information: Q9NY64  
  • Name: Solute carrier family 2, facilitated glucose transporter member 8 (Glucose transporter type 8) (GLUT 8) (Glucose transporter type X1)
  • Length: 477  
  • Mass: 50819
  • Tissue specificity: Highly expressed in testis, but not in testicular carcinoma. Lower amounts present in most other tissues. {ECO
• Sequence:

  MTPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLQRAAPPAPRLDDAAASWFGAV
  VTLGAAAGGVLGGWLVDRAGRKLSLLLCSVPFVAGFAVITAAQDVWMLLGGRLLTGLACGVASLVAPVYISEIAY
  PAVRGLLGSCVQLMVVVGILLAYLAGWVLEWRWLAVLGCVPPSLMLLLMCFMPETPRFLLTQHRRQEAMAALRFL
  WGSEQGWEDPPIGAEQSFHLALLRQPGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSSLASVVVGV
  IQVLFTAVAALIMDRAGRRLLLVLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAWLAV
  GSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLMAFLVTKEFSSLMEVLRPYGAFWLASAFCIF
  SVLFTLFCVPETKGKTLEQITAHFEGR

• Structural information:
  • Interpro: IPR020846  IPR005828  IPR036259  IPR003663  IPR005829  
  • Prosite: PS50850 PS00216 PS00217
  • STRING: ENSP00000362469
• Other Databases: GeneCards:  SLC2A8  Malacards:  SLC2A8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046323	glucose import	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005351	carbohydrate:proton symporter activity	IBA	molecular function
GO:0070837	dehydroascorbic acid transport	ISS	biological process
GO:0033300	dehydroascorbic acid transmembrane transporter activity	ISS	molecular function
GO:0005355	glucose transmembrane transporter activity	ISS	molecular function
GO:0005353	fructose transmembrane transporter activity	ISS	molecular function
GO:1904659	glucose transmembrane transport	ISS	biological process
GO:0015755	fructose transmembrane transport	ISS	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0005355	glucose transmembrane transporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:1904659	glucose transmembrane transport	TAS	biological process
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0008645	hexose transmembrane transport	TAS	biological process
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0005536	glucose binding	IEA	molecular function
GO:0008286	insulin receptor signaling pathway	IEA	biological process
GO:0070837	dehydroascorbic acid transport	IEA	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0070837	dehydroascorbic acid transport	IEA	biological process
GO:0005353	fructose transmembrane transporter activity	IEA	molecular function
GO:0005355	glucose transmembrane transporter activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0015755	fructose transmembrane transport	IEA	biological process
GO:0033300	dehydroascorbic acid transmembrane transporter activity	IEA	molecular function
GO:1904659	glucose transmembrane transport	IEA	biological process
GO:0007141	male meiosis I	IEA	biological process
GO:0033300	dehydroascorbic acid transmembrane transporter activity	IEA	molecular function
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:1902600	proton transmembrane transport	IEA	biological process
GO:0005765	lysosomal membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray